Align 2-oxoacid:ferredoxin oxidoreductase 1, subunit beta; Short=OFOR1; EC 1.2.7.11 (characterized, see rationale)
to candidate 8501323 DvMF_2056 thiamine pyrophosphate protein domain protein TPP-binding (RefSeq)
Query= uniprot:OFOB1_SULTO (305 letters) >FitnessBrowser__Miya:8501323 Length = 263 Score = 89.0 bits (219), Expect = 1e-22 Identities = 62/201 (30%), Positives = 93/201 (46%), Gaps = 15/201 (7%) Query: 11 WCPGCGNFGILNAEQQAIVELGVDTKNVVVVSGIGCSGKIPHFFRTPISGVHTLHGRAIA 70 +CPGC + + + E+GV + + V+ IGCS I ++ + V HGRA A Sbjct: 30 YCPGCHHGIAHRLVAEVLEEMGV-VDDTICVASIGCSVFIYNYLA--VDSVEAPHGRAPA 86 Query: 71 FATGIKLSNPDLVVIVNGGDGDLLGIGAGHFVAAGRRNVDMVVILHDNGVYGLTKGQASP 130 ATG+K D +V GDGDL IG + A R + ++ +N VYG+T GQ +P Sbjct: 87 VATGVKRGRTDKIVFTYQGDGDLASIGLAEVMHAANRGERITIVFVNNTVYGMTGGQMAP 146 Query: 131 TLKRGEKPKSLPRPNINDAVN-PIALAI----SSGYTFVARGYAYDVKHLKELIKSAIK- 184 T G+K + P D PI +A G + AR VK+++ K+ K Sbjct: 147 TTLIGQKTTTCPGGRCRDREGMPIRMAEIIAGLGGVAYSARASLDSVKNIRAAKKAVRKA 206 Query: 185 ------HKGLALIDVLQPCPT 199 G +++L CPT Sbjct: 207 FDVQQQGLGFGFVELLSGCPT 227 Lambda K H 0.318 0.139 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 177 Number of extensions: 11 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 263 Length adjustment: 26 Effective length of query: 279 Effective length of database: 237 Effective search space: 66123 Effective search space used: 66123 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory