Align 3-isopropylmalate dehydrogenase (EC 1.1.1.85) (characterized)
to candidate 8501058 DvMF_1794 3-isopropylmalate dehydrogenase (RefSeq)
Query= BRENDA::P93832 (405 letters) >FitnessBrowser__Miya:8501058 Length = 358 Score = 414 bits (1065), Expect = e-120 Identities = 219/354 (61%), Positives = 259/354 (73%), Gaps = 1/354 (0%) Query: 45 ITLLPGDGIGPEVVSIAKNVLQQAGSLEGVEFNFREMPIGGAALDLVGVPLPEETISAAK 104 I L+PGDGIGPE+V A VL + G ++ IGGAA+D G PLP+ET++A K Sbjct: 5 ICLMPGDGIGPEIVEQAVKVLDKVAKKFGHTVSYTNALIGGAAIDATGGPLPDETVAACK 64 Query: 105 ESDAVLLGAIGGYKWDNNEKHLRPEKGLLQIRAALKVFANLRPATVLPQLVDASTLKREV 164 +DAVLLGA+GG KWD +RPEKGLL IR AL +FANLRPAT+LP+L A L+ ++ Sbjct: 65 AADAVLLGAVGGPKWDTLPTAIRPEKGLLGIRKALGLFANLRPATLLPELAGACLLRADI 124 Query: 165 A-EGVDLMVVRELTGGIYFGEPRGIKTNENGEEVGFNTEVYAAHEIDRIARVAFETARKR 223 A +G+D+MVVRELTGG+YFGEP + +G +NT +Y E+ RIARVAFE ARKR Sbjct: 125 AAQGLDVMVVRELTGGVYFGEPVCEEELRDGLRTSYNTMIYNEEEVRRIARVAFEAARKR 184 Query: 224 RGKLCSVDKANVLEASILWRKRVTALASEYPDVELSHMYVDNAAMQLVRDPKQFDTIVTN 283 K+CSVDKANVL S LWR V +A EYPDVEL+HMYVDNAAMQLVR P QFD IVT Sbjct: 185 SRKVCSVDKANVLAVSRLWRAVVIEVAREYPDVELTHMYVDNAAMQLVRWPAQFDVIVTE 244 Query: 284 NIFGDILSDEASMITGSIGMLPSASLSDSGPGLFEPIHGSAPDIAGQDKANPLATILSAA 343 N+FGDILSDEA++ITGSIGMLPSASL SGPG+FEPIHGSAPDIAGQ+KANP+ATILS A Sbjct: 245 NLFGDILSDEAAVITGSIGMLPSASLGASGPGIFEPIHGSAPDIAGQNKANPVATILSVA 304 Query: 344 MLLKYGLGEEKAAKRIEDAVLVALNNGFRTGDIYSAGTKLVGCKEMGEEVLKSV 397 M+L+Y G EK A IE AV L G+RTGDI G LVG MG V + V Sbjct: 305 MMLRYTFGLEKEAVAIEQAVSGVLREGYRTGDIMEEGKTLVGTVSMGNLVTERV 358 Lambda K H 0.316 0.134 0.374 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 417 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 358 Length adjustment: 30 Effective length of query: 375 Effective length of database: 328 Effective search space: 123000 Effective search space used: 123000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 8501058 DvMF_1794 (3-isopropylmalate dehydrogenase (RefSeq))
to HMM TIGR00169 (leuB: 3-isopropylmalate dehydrogenase (EC 1.1.1.85))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00169.hmm # target sequence database: /tmp/gapView.28687.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00169 [M=349] Accession: TIGR00169 Description: leuB: 3-isopropylmalate dehydrogenase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-162 526.9 0.0 1.3e-162 526.7 0.0 1.0 1 lcl|FitnessBrowser__Miya:8501058 DvMF_1794 3-isopropylmalate dehy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8501058 DvMF_1794 3-isopropylmalate dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 526.7 0.0 1.3e-162 1.3e-162 1 347 [. 4 352 .. 4 354 .. 0.98 Alignments for each domain: == domain 1 score: 526.7 bits; conditional E-value: 1.3e-162 TIGR00169 1 kiavLpGDgiGpevvaealkvLkaveerfelklefeealiGGaaidatgePlpeetlkackeadavLlgavGGpkWd 77 ki ++pGDgiGpe+v++a+kvL++v+++f++ + + +aliGGaaidatg Plp+et++ack+adavLlgavGGpkWd lcl|FitnessBrowser__Miya:8501058 4 KICLMPGDGIGPEIVEQAVKVLDKVAKKFGHTVSYTNALIGGAAIDATGGPLPDETVAACKAADAVLLGAVGGPKWD 80 799************************************************************************** PP TIGR00169 78 nlprdvrPekgLLklrkeldlfanLrPaklfksLeklsplkeeiv.kgvDlvvvreLtgGiYfGepkereeaee.ek 152 +lp+ +rPekgLL +rk l+lfanLrPa+l ++L ++ l+++i+ +g+D++vvreLtgG+YfGep +ee + + lcl|FitnessBrowser__Miya:8501058 81 TLPTAIRPEKGLLGIRKALGLFANLRPATLLPELAGACLLRADIAaQGLDVMVVRELTGGVYFGEPVCEEELRDgLR 157 ********************************************989*******************99988777799 PP TIGR00169 153 kaldtekYtkeeieriarvafelarkrrkkvtsvDkanvLessrlWrktveeiakeyPdvelehlyiDnaamqLvks 229 ++++t+ Y++ee++riarvafe+arkr +kv+svDkanvL++srlWr +v e+a+eyPdvel h+y+DnaamqLv+ lcl|FitnessBrowser__Miya:8501058 158 TSYNTMIYNEEEVRRIARVAFEAARKRSRKVCSVDKANVLAVSRLWRAVVIEVAREYPDVELTHMYVDNAAMQLVRW 234 9**************************************************************************** PP TIGR00169 230 PeqldvvvtsnlfGDilsDeasvitGslGlLPsaslsskglalfepvhgsapdiagkgianpiaailsaalllrysl 306 P+q+dv+vt+nlfGDilsDea+vitGs+G+LPsasl+ +g ++fep+hgsapdiag++ anp+a+ils+a++lry++ lcl|FitnessBrowser__Miya:8501058 235 PAQFDVIVTENLFGDILSDEAAVITGSIGMLPSASLGASGPGIFEPIHGSAPDIAGQNKANPVATILSVAMMLRYTF 311 ***************************************************************************** PP TIGR00169 307 nleeaaeaieaavkkvleegkrtedlaseattavstkevee 347 +le++a aie+av+ vl+eg+rt d+++e+ t v+t ++++ lcl|FitnessBrowser__Miya:8501058 312 GLEKEAVAIEQAVSGVLREGYRTGDIMEEGKTLVGTVSMGN 352 **********************************9998876 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (349 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 10.46 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory