Align LL-diaminopimelate aminotransferase (EC 2.6.1.83) (characterized)
to candidate 8499593 DvMF_0361 LL-diaminopimelate aminotransferase (RefSeq)
Query= BRENDA::O66630 (387 letters) >FitnessBrowser__Miya:8499593 Length = 389 Score = 472 bits (1215), Expect = e-138 Identities = 236/386 (61%), Positives = 289/386 (74%), Gaps = 2/386 (0%) Query: 2 FEFSDRLKVLPPYLFAELDRKKQEKIEQGVDVIDLGVGDPDMPTPKPIVEAAKKALENPE 61 F+ +DRL LPPYLFA +D+ K E +GVD+I LG+GDPDMPTP I+EA KKA+E P Sbjct: 4 FKLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMPTPDFIIEAMKKAVERPA 63 Query: 62 NHKYPSYVGKYEFRKAVADWYKRRFDVDLDPNTEVITLIGSKEGIAHFPLAFVNPGDIVL 121 NH+YPSYVG EFR+ VA+WY RRF V LDP TEVI LIGSKEGIAHFPLAFVNPGD+VL Sbjct: 64 NHQYPSYVGMLEFRQEVANWYGRRFGVSLDPKTEVIGLIGSKEGIAHFPLAFVNPGDLVL 123 Query: 122 CPDPAYPVYRIGAIFAGGTPYTVPLKEENNFLPDLDSIPEDVAKKAKIIWINYPNNPTSA 181 P YPVY I F GG +PL EEN++LPDLD+IP +AK+I++NYPNNPT+A Sbjct: 124 VCTPNYPVYHIATGFVGGEVQFIPLVEENDYLPDLDAIPAATWDRAKMIFVNYPNNPTAA 183 Query: 182 PPTLEFYKKLVDWAKEYNVIIASDNAYSEIYTGQ-EKPPSILQVPGAKDVAIEFHSLSKT 240 FY+KL+ +++NVIIA D AY+E+Y + +KP SIL+V GAKDV IEFHSLSKT Sbjct: 184 TAPRAFYEKLIGICRKHNVIIAHDTAYTEVYYDENDKPMSILEVEGAKDVTIEFHSLSKT 243 Query: 241 YNMTGWRIGMAVGNKELVAGLGKVKTNVDSGQFGAVQDAGIVALNLPEEEVEKIRDVYRE 300 YNMTGWR+GMAVGN LVAGLGKVK NVDSG F AVQ+A IVAL ++ ++R +YR+ Sbjct: 244 YNMTGWRVGMAVGNASLVAGLGKVKENVDSGIFQAVQEASIVALRDGDDFCRELRGIYRK 303 Query: 301 RKKIMTEALEKIGLEIYRSDYTFYLWIKVPEGY-TSAEFVGRLIDEAGIVCTPGNGFGEY 359 R+ ++ AL K+G+ FY+W KVP GY +SAEFV ++++ G+V TPGNGFG Sbjct: 304 RRDVVVAALNKVGIACRVPTAAFYIWAKVPAGYGSSAEFVTAVLEKTGVVLTPGNGFGTP 363 Query: 360 GEGYFRISLTVPTERLLEAAERIKNL 385 GEGYFRISLTV T+RL EA RI NL Sbjct: 364 GEGYFRISLTVDTDRLEEAVSRIANL 389 Lambda K H 0.317 0.139 0.413 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 506 Number of extensions: 17 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 387 Length of database: 389 Length adjustment: 30 Effective length of query: 357 Effective length of database: 359 Effective search space: 128163 Effective search space used: 128163 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 8499593 DvMF_0361 (LL-diaminopimelate aminotransferase (RefSeq))
to HMM TIGR03540 (LL-diaminopimelate aminotransferase (EC 2.6.1.83))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR03540.hmm # target sequence database: /tmp/gapView.30703.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR03540 [M=383] Accession: TIGR03540 Description: DapC_direct: LL-diaminopimelate aminotransferase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.2e-192 623.3 0.0 8.1e-192 623.2 0.0 1.0 1 lcl|FitnessBrowser__Miya:8499593 DvMF_0361 LL-diaminopimelate ami Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499593 DvMF_0361 LL-diaminopimelate aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 623.2 0.0 8.1e-192 8.1e-192 1 382 [. 5 388 .. 5 389 .] 0.99 Alignments for each domain: == domain 1 score: 623.2 bits; conditional E-value: 8.1e-192 TIGR03540 1 klaerleklPPylfaeidklkaekkakGvdvidlgiGdPdlptpkeivealkkaaekpenhryPsyeGllayrkava 77 kla+rl++lPPylfa idk+kae++a+Gvd+i+lgiGdPd+ptp+ i+ea+kka+e+p+nh+yPsy+G+l++r++va lcl|FitnessBrowser__Miya:8499593 5 KLADRLATLPPYLFAGIDKVKAEVAARGVDIISLGIGDPDMPTPDFIIEAMKKAVERPANHQYPSYVGMLEFRQEVA 81 589************************************************************************** PP TIGR03540 78 dwykkrfgveldpetevlsliGskeGiahlplafvnpGdivlvpdPgyPvykistllaggepyelPlkeendflPdl 154 +wy +rfgv ldp+tev++liGskeGiah+plafvnpGd+vlv+ P yPvy+i+t ++gge++ +Pl eend+lPdl lcl|FitnessBrowser__Miya:8499593 82 NWYGRRFGVSLDPKTEVIGLIGSKEGIAHFPLAFVNPGDLVLVCTPNYPVYHIATGFVGGEVQFIPLVEENDYLPDL 158 ***************************************************************************** PP TIGR03540 155 daipedvlkkakilflnyPnnPtsavadkeffkevvefakeyniivvhdaayseivfdey.kalsflevdgakdvai 230 daip+ ++ +ak++f+nyPnnPt+a+a++ f+++++ +++++n+i++hd+ay+e+++de+ k++s+lev+gakdv+i lcl|FitnessBrowser__Miya:8499593 159 DAIPAATWDRAKMIFVNYPNNPTAATAPRAFYEKLIGICRKHNVIIAHDTAYTEVYYDENdKPMSILEVEGAKDVTI 235 *********************************************************9753799************* PP TIGR03540 231 elhslsktynmtGWrigfavGnkeliaalgkvksnvdsGvfqaiqeaaiaaleeeeevvkelrkvykkrrdllveal 307 e+hslsktynmtGWr+g+avGn++l+a+lgkvk+nvdsG+fqa+qea+i+al++ +++ +elr +y+krrd++v+al lcl|FitnessBrowser__Miya:8499593 236 EFHSLSKTYNMTGWRVGMAVGNASLVAGLGKVKENVDSGIFQAVQEASIVALRDGDDFCRELRGIYRKRRDVVVAAL 312 ***************************************************************************** PP TIGR03540 308 kkiGldvkkpkatfylWvkvPeGy.tsaefakklleeagvvvtpGvgfGesGeGyirisltvseerlkeaverlkk 382 +k+G+ ++ p a+fy+W+kvP+Gy +saef++ +le++gvv+tpG+gfG+ GeGy+risltv+++rl+eav+r+++ lcl|FitnessBrowser__Miya:8499593 313 NKVGIACRVPTAAFYIWAKVPAGYgSSAEFVTAVLEKTGVVLTPGNGFGTPGEGYFRISLTVDTDRLEEAVSRIAN 388 ***********************94578**********************************************87 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (383 nodes) Target sequences: 1 (389 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 9.12 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory