Align diaminopimelate decarboxylase (EC 4.1.1.20) (characterized)
to candidate 8499585 DvMF_0353 diaminopimelate decarboxylase (RefSeq)
Query= BRENDA::Q9KVL7 (417 letters) >FitnessBrowser__Miya:8499585 Length = 416 Score = 451 bits (1161), Expect = e-131 Identities = 233/413 (56%), Positives = 302/413 (73%), Gaps = 3/413 (0%) Query: 1 MDYFNYQEDGQLWAEQVPLADLANQYGTPLYVYSRATLERHWHAFDKSVGDYPHLICYAV 60 M +F Y+E GQL+AE VP+ +LA++YGTPLYVYS ATL RH+ AFD + HL CY+V Sbjct: 1 MHHFQYRE-GQLYAEGVPVHELASRYGTPLYVYSAATLRRHFQAFDSAFTGVGHLTCYSV 59 Query: 61 KANSNLGVLNTLARLGSGFDIVSVGELERVLAAGGDPSKVVFSGVGKTEAEMKRALQLKI 120 KANSN+ +L LA +G+G DIVS GEL R LAAG ++V+SGVGK + E++ AL+ I Sbjct: 60 KANSNVHLLRLLADMGAGMDIVSGGELHRALAAGVPGQRIVYSGVGKQDDEIRAALEADI 119 Query: 121 KCFNVESEPELQRLNKVAGELGVKAPISLRINPDVDAKTHPYISTGLRDNKFGITFDRAA 180 FNVES EL+R+N VAG++G A I +RINPDVD KTHPYISTG+R+NKFG+ ++A Sbjct: 120 LLFNVESVQELERINAVAGQMGRTARIGVRINPDVDPKTHPYISTGMRNNKFGLDMEQAL 179 Query: 181 QVYRLAHSLPNLDVHGIDCHIGSQLTALAPFIDATDRLLALIDSLKAEGIHIRHLDVGGG 240 Y LA LPN+ GIDCHIGSQLT LAPF++A DR+L + L+ G+ I HLD+GGG Sbjct: 180 AAYLLARDLPNVQPVGIDCHIGSQLTTLAPFLEALDRVLDFHERLRDLGLAITHLDLGGG 239 Query: 241 LGVVYRDELPPQPSEYAKALLDRLERHRDLELIFEPGRAIAANAGVLVTKVEFLKHTEHK 300 LG+ Y +E PP P E+ +A+ +RL R R L LI EPGR IA NAG+LV +V + K T K Sbjct: 240 LGITYGEETPPHPREFGEAVSERL-RGRGLSLILEPGRVIAGNAGILVGRVIYTKSTPSK 298 Query: 301 NFAIIDAAMNDLIRPALYQAWQDIIPLRPRQGEAQTYDLVGPVCETSDFLGKDRDLV-LQ 359 NF I DAAMNDL+RP+LYQ++ I ++P + T D+VGP+CE+ DFL +DR L +Q Sbjct: 299 NFIIADAAMNDLVRPSLYQSYHRIAEVQPAGRDEITADVVGPICESGDFLARDRILPDMQ 358 Query: 360 EGDLLAVRSSGAYGFTMSSNYNTRPRVAEVMVDGNKTYLVRQREELSSLWALE 412 +G+LLAV S+GAYGF+MSSNYN+RPR AEV+VDG +R+RE L+ L A E Sbjct: 359 QGELLAVFSAGAYGFSMSSNYNSRPRAAEVLVDGATARCIRKRETLADLVAPE 411 Lambda K H 0.319 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 507 Number of extensions: 19 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 417 Length of database: 416 Length adjustment: 31 Effective length of query: 386 Effective length of database: 385 Effective search space: 148610 Effective search space used: 148610 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 8499585 DvMF_0353 (diaminopimelate decarboxylase (RefSeq))
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.28085.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.1e-165 537.2 0.0 1.2e-165 537.0 0.0 1.0 1 lcl|FitnessBrowser__Miya:8499585 DvMF_0353 diaminopimelate decarb Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Miya:8499585 DvMF_0353 diaminopimelate decarboxylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 537.0 0.0 1.2e-165 1.2e-165 4 416 .. 6 411 .. 3 412 .. 0.98 Alignments for each domain: == domain 1 score: 537.0 bits; conditional E-value: 1.2e-165 TIGR01048 4 kkdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvs 80 ++g+l++egv+++ela ++gtPlYvy+++tlr++++a+++af++ +l +Y vKAnsn+++lrlla+ G+g+d+vs lcl|FitnessBrowser__Miya:8499585 6 YREGQLYAEGVPVHELASRYGTPLYVYSAATLRRHFQAFDSAFTGVGHLTCYSVKANSNVHLLRLLADMGAGMDIVS 82 6789*****************************************99****************************** PP TIGR01048 81 gGEleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdakth 157 gGEl ralaAgv+ ++iv+sg+gk+++e++aale++i l+nv+sv+ele+++++a+++g +ar+ +R+npdvd+kth lcl|FitnessBrowser__Miya:8499585 83 GGELHRALAAGVPGQRIVYSGVGKQDDEIRAALEADILLFNVESVQELERINAVAGQMGRTARIGVRINPDVDPKTH 159 ***************************************************************************** PP TIGR01048 158 eyisTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldl 234 +yisTG++++KFG+++e+a++ay la +l+++++vGi++HIGSq++ l+pf ea+++v+++ e+l++ g+ +++ldl lcl|FitnessBrowser__Miya:8499585 160 PYISTGMRNNKFGLDMEQALAAYLLARDLPNVQPVGIDCHIGSQLTTLAPFLEALDRVLDFHERLRDLGLAITHLDL 236 ***************************************************************************** PP TIGR01048 235 GGGlgisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagm 311 GGGlgi+y ee+ +p+++e+ e++ e+l++ + l+lilEpGR +++nag+l+ rV ++K+++s++f++ Da+m lcl|FitnessBrowser__Miya:8499585 237 GGGLGITYGEET-PPHPREFGEAVSERLRG-----RGLSLILEPGRVIAGNAGILVGRVIYTKSTPSKNFIIADAAM 307 *********999.************99999.....699*************************************** PP TIGR01048 312 ndliRpalYeayheiaalkrleeeetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrp 388 ndl+Rp+lY++yh+ia+++ + + t+dvvGp+CEsgD+la+dr lp++++G+llav+saGAYg+smssnYnsrp lcl|FitnessBrowser__Miya:8499585 308 NDLVRPSLYQSYHRIAEVQ-PAGRDEITADVVGPICESGDFLARDRILPDMQQGELLAVFSAGAYGFSMSSNYNSRP 383 ******************5.5777799************************************************** PP TIGR01048 389 rpaevlveegkarlirrretledllale 416 r+aevlv++ ar ir+retl+dl+a e lcl|FitnessBrowser__Miya:8499585 384 RAAEVLVDGATARCIRKRETLADLVAPE 411 ************************9977 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (416 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.99 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory