Align Putative [LysW]-aminoadipate semialdehyde/glutamate semialdehyde transaminase; EC 2.6.1.118; EC 2.6.1.124 (uncharacterized)
to candidate 8502443 DvMF_3149 acetylornithine aminotransferase (RefSeq)
Query= curated2:Q5JFW3 (362 letters) >FitnessBrowser__Miya:8502443 Length = 402 Score = 240 bits (612), Expect = 5e-68 Identities = 139/376 (36%), Positives = 213/376 (56%), Gaps = 21/376 (5%) Query: 5 RKRLRLVRGEGVYVWDEKGRRYLDLIAGIGVNVLGHAHPEWVLDMSRQLEKIVVAGPMFE 64 R + + RG+G +WD GR Y+DL++GI V LGH H E + Q K+V +F Sbjct: 22 RYPISVARGQGSRLWDVDGREYVDLLSGIAVTSLGHCHEELAEVAAAQARKLVHVSNLFY 81 Query: 65 HDEREEMLEELSHWVDYEYVYMGNSGTEAVEAAIKFARL----ATGRS--EIVAMTNAFH 118 +E+ ++ E L + NSG EA EAAIK AR GR EI+ +T AFH Sbjct: 82 QEEQLDLAERLLSTSHCTKAFFCNSGAEANEAAIKLARRYMQRVQGREAYEIITLTGAFH 141 Query: 119 GRTLGSLSATWKKKYREGFGPLVPGFKHIPFNNVEAAKEAITKETAAVIFEPIQGEGGIV 178 GRTL +++AT + K+++GF P+ GF+ +P ++EA + AI +TA V+ E +QGEGG+ Sbjct: 142 GRTLATVAATGQAKFQDGFYPMPEGFRQVPSGDIEALRAAIGPQTAGVLVEVVQGEGGVC 201 Query: 179 PADEEFVKTLRDLTEDVGALLIADEVQSGL-RTGKFLAIEHYGVRPDIVTMGKGIGNGFP 237 P D ++ + ++ L + G L + DE+Q+G+ RTG+F + ++YG+ PDIV+ K + NG P Sbjct: 202 PLDPDYARAVQALCREKGVLFMTDEIQAGMCRTGRFWSFQNYGLEPDIVSCAKALANGLP 261 Query: 238 VSLTLTDLEIPR----GKHGSTFGGNPLACRAVATTLRILRRDRLVEKA---GEKFME-- 288 + +T E+ R G H +TFG L + T+ I+ RD L +A G + M+ Sbjct: 262 MGAMMTTDEVARGFVAGSHATTFGAGALVSAVASRTVEIMLRDDLAGRAATEGARIMDRF 321 Query: 289 -FSGERVVKT----RGRGLMIGIVLRRPAGNYVKALQERGILVNTAGNRVIRLLPPLIIE 343 G+++ T RG GLMIG+VL P +AL +RG + N + V+RLLP L I Sbjct: 322 RAMGQKLPGTIDHVRGLGLMIGVVLAFPGKEVWQALIDRGFICNLTQDCVLRLLPALTIP 381 Query: 344 GDTLEEARKEIEGVLN 359 L+ +E +L+ Sbjct: 382 RADLDAFADALEDILS 397 Lambda K H 0.320 0.140 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 335 Number of extensions: 12 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 402 Length adjustment: 30 Effective length of query: 332 Effective length of database: 372 Effective search space: 123504 Effective search space used: 123504 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory