Align L-amino acid N-acyltransferase MnaT; L-methionine N-acyltransferase; L-methionine sulfoximine/L-methionine sulfone N-acetyltransferase; L-phenylglycine N-acetyltransferase; EC 2.3.1.- (characterized)
to candidate 8499697 DvMF_0463 GCN5-related N-acetyltransferase (RefSeq)
Query= SwissProt::P76112 (172 letters) >FitnessBrowser__Miya:8499697 Length = 178 Score = 197 bits (500), Expect = 1e-55 Identities = 99/175 (56%), Positives = 117/175 (66%), Gaps = 5/175 (2%) Query: 1 MSIRFARKADCAAIAEIYNHAVLYTAAIWNDQTVDADNRIAWFEARTLAGYPVLVSEENG 60 M IR A D I IYN AV T AIWN+ DA R AW R AG+PVLV+ E G Sbjct: 1 MLIRDAESGDIEGIVAIYNDAVCNTTAIWNESVTDAAGRAAWLADRRAAGHPVLVAVEAG 60 Query: 61 -----VVTGYASFGDWRSFDGFRHTVEHSVYVHPDHQGKGLGRKLLSRLIDEARDCGKHV 115 VV GYA+FGDWR++DG+RHTVEHSVYVH D +G+GLG LL LI ARD GKHV Sbjct: 61 RNGGPVVLGYATFGDWRAWDGYRHTVEHSVYVHKDTRGRGLGAALLHALIGRARDMGKHV 120 Query: 116 MVAGIESQNQASLHLHQSLGFVVTAQMPQVGTKFGRWLDLTFMQLQLDERTEPDA 170 MVAG+E+ N+AS+ LH+ +GF + +VG KFGRWLDL F+QL LD R P A Sbjct: 121 MVAGVEAGNEASMALHRKMGFTEVGMLREVGCKFGRWLDLAFLQLTLDARETPPA 175 Lambda K H 0.322 0.136 0.420 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 128 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 172 Length of database: 178 Length adjustment: 19 Effective length of query: 153 Effective length of database: 159 Effective search space: 24327 Effective search space used: 24327 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 44 (21.6 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory