Align Putative [LysW]-aminoadipate/[LysW]-glutamate kinase; EC 2.7.2.- (uncharacterized)
to candidate 8499536 DvMF_0306 acetylglutamate kinase (RefSeq)
Query= curated2:A0RWW1 (266 letters) >FitnessBrowser__Miya:8499536 Length = 320 Score = 128 bits (321), Expect = 2e-34 Identities = 88/255 (34%), Positives = 138/255 (54%), Gaps = 13/255 (5%) Query: 2 ITIKIGGSIV--DSLHPSAIPDIKKAAAGGV--VLVHGGGKEVTKVCEQLGKEPRFVTSP 57 + IK GG + ++L + +I G+ V+VHGGG ++ ++ EQL + +F Sbjct: 40 VVIKYGGHAMKDEALKKAFALNIALLKQVGINPVVVHGGGPQIGRMLEQLHIQSQFREG- 98 Query: 58 GNIKSRYTDKETAEIFTMVMSGRINKCIVRMLQQHGVNAVGLSGIDGGLIRAERKSRLVI 117 R TD T ++ MV+ G++NK IV +L GV AVGLSG DG LIRA RK +++ Sbjct: 99 ----LRVTDDATMDVVEMVLVGKVNKEIVNLLNLSGVKAVGLSGKDGQLIRA-RKMEMIV 153 Query: 118 VNERGRKQAIEGGYTGRITSVNSELLETLLGKGIVPVVSPIAMGNEYELLNVDGDRAAAN 177 + I+ G G + V + LL +L VPV++P+ + E N++ D A Sbjct: 154 NGGNHAPEIIDLGKVGEVMRVETTLLRSLERDNFVPVIAPVGVDENGETYNINADAVAGA 213 Query: 178 IAGATKSERILFVTDVDGLMMDEK-LVSRLSAAEAEEI--RPKIGPGMEKKVLAATEALK 234 +A A +++R+L +TDV G++ +K L+ L+ EA E+ + GM KV EAL+ Sbjct: 214 VAAALRAKRLLLLTDVAGILDKQKELIRSLTTREAVELFTDGTLTGGMIPKVKCCLEALE 273 Query: 235 MGVREAIIARGSREN 249 GV +A+I G EN Sbjct: 274 EGVEKAMIVDGRVEN 288 Lambda K H 0.316 0.135 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 207 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 266 Length of database: 320 Length adjustment: 26 Effective length of query: 240 Effective length of database: 294 Effective search space: 70560 Effective search space used: 70560 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory