GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serA in Desulfovibrio vulgaris Miyazaki F

Align D-3-phosphoglycerate dehydrogenase; PGDH; EC 1.1.1.95 (uncharacterized)
to candidate 8499437 DvMF_0209 D-isomer specific 2-hydroxyacid dehydrogenase NAD-binding (RefSeq)

Query= curated2:O29445
         (527 letters)



>lcl|FitnessBrowser__Miya:8499437 DvMF_0209 D-isomer specific
           2-hydroxyacid dehydrogenase NAD-binding (RefSeq)
          Length = 322

 Score =  173 bits (438), Expect = 1e-47
 Identities = 106/289 (36%), Positives = 147/289 (50%), Gaps = 8/289 (2%)

Query: 34  ELIREVPKYEAIVVRSQTKVDAEVIQAAKNLKIIGRAGVGVDNIDINAATQRGIVVVNAP 93
           E IRE      +V+ ++T +DA+ I A  +L  IG    G D +DI AA  R I V N P
Sbjct: 36  EAIRERAAGAHMVLTNKTPLDADTIAALPDLAYIGVLATGYDVVDIRAAAARSIPVCNVP 95

Query: 94  GGNTISTAEHAIALMLAAARKIPQADRSVKEGKWERKK------FMGIELRGKTAGVIGL 147
           G  T + A+H  A +L   R+I + D SVK G W   K         IEL GK  G++G 
Sbjct: 96  GYGTEAVAQHVFAFLLELCRRIARHDASVKVGNWSANKDWCFWETTQIELTGKAMGIVGF 155

Query: 148 GRVGFEVAKRCKALEMNVLAYDPFVSKERAEQIGVKLVDFDTLLASSDVITVHVPRTKET 207
           G +G  V +   A  M VLAY P        +     V  D L A SDV+T+H P T  T
Sbjct: 156 GNMGKRVGQIANAFGMKVLAYSPNTRTMPGYE-PFAYVSLDELFARSDVVTLHCPLTDAT 214

Query: 208 IGLIGKGQFEKMKDGVIVVNAARGGIVDEAALYEAIKAGKVAAAALDVYEKEPPSPDNPL 267
            G++ + +   MK G I++N ARG ++DEAA+  A+    +    +DV   EP  PDNPL
Sbjct: 215 RGMVNRVRLASMKQGAILINTARGPLLDEAAVAAALNDNHLGGLGVDVVAVEPIRPDNPL 274

Query: 268 LKLDNVVTTPHIAASTREAQLNVGMIIAEDIVNMAKGLPVRNAVNLPSI 316
           L   N + TPH+A +T  A+  +  + A +I     G P  N V  P++
Sbjct: 275 LTAKNCLITPHLAWATLTARQTLMRVTAGNIRAFLAGAPT-NVVKAPTV 322


Lambda     K      H
   0.317    0.136    0.376 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 327
Number of extensions: 18
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 527
Length of database: 322
Length adjustment: 31
Effective length of query: 496
Effective length of database: 291
Effective search space:   144336
Effective search space used:   144336
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory