GapMind for Amino acid biosynthesis

 

Aligments for a candidate for trpE in Desulfovibrio vulgaris Miyazaki F

Align Anthranilate synthase; EC 4.1.3.27 (characterized, see rationale)
to candidate 8501009 DvMF_1746 Anthranilate synthase (RefSeq)

Query= uniprot:B8DM47_DESVM
         (520 letters)



>lcl|FitnessBrowser__Miya:8501009 DvMF_1746 Anthranilate synthase
           (RefSeq)
          Length = 520

 Score = 1041 bits (2692), Expect = 0.0
 Identities = 520/520 (100%), Positives = 520/520 (100%)

Query: 1   MEMPEMPAQAEAPETAKAPQAPETAQAPANGNGCPCATTGSGDDIPALPEGGEIVLRQTG 60
           MEMPEMPAQAEAPETAKAPQAPETAQAPANGNGCPCATTGSGDDIPALPEGGEIVLRQTG
Sbjct: 1   MEMPEMPAQAEAPETAKAPQAPETAQAPANGNGCPCATTGSGDDIPALPEGGEIVLRQTG 60

Query: 61  RWLEADVDTPISVFLGMVGSGQGILLESAEVDGRWGRFSVIAFNFLLRLGCRDGKLEVAV 120
           RWLEADVDTPISVFLGMVGSGQGILLESAEVDGRWGRFSVIAFNFLLRLGCRDGKLEVAV
Sbjct: 61  RWLEADVDTPISVFLGMVGSGQGILLESAEVDGRWGRFSVIAFNFLLRLGCRDGKLEVAV 120

Query: 121 RDPRLAPLRRFDGMGFIEGTRAVMRALRIEPDAAFADQPPITRALYGYFGYGVSGLFEPK 180
           RDPRLAPLRRFDGMGFIEGTRAVMRALRIEPDAAFADQPPITRALYGYFGYGVSGLFEPK
Sbjct: 121 RDPRLAPLRRFDGMGFIEGTRAVMRALRIEPDAAFADQPPITRALYGYFGYGVSGLFEPK 180

Query: 181 LAKVLPTSSAEACLALPGTVVLFDHLYNRLCQLSLTDLPGGRVDRSQVDRTPEPPEVGPV 240
           LAKVLPTSSAEACLALPGTVVLFDHLYNRLCQLSLTDLPGGRVDRSQVDRTPEPPEVGPV
Sbjct: 181 LAKVLPTSSAEACLALPGTVVLFDHLYNRLCQLSLTDLPGGRVDRSQVDRTPEPPEVGPV 240

Query: 241 VNVPEQAVYTRAVARVKDMIRQGEAIQVVLSTRFQASFSGDPFTLYRRLRRINPSPYMFF 300
           VNVPEQAVYTRAVARVKDMIRQGEAIQVVLSTRFQASFSGDPFTLYRRLRRINPSPYMFF
Sbjct: 241 VNVPEQAVYTRAVARVKDMIRQGEAIQVVLSTRFQASFSGDPFTLYRRLRRINPSPYMFF 300

Query: 301 MRLPGVSLLGSSPEVMVRCRADKLQVSPIAGTRPRGTDDAHDAALARELLEDPKERAEHV 360
           MRLPGVSLLGSSPEVMVRCRADKLQVSPIAGTRPRGTDDAHDAALARELLEDPKERAEHV
Sbjct: 301 MRLPGVSLLGSSPEVMVRCRADKLQVSPIAGTRPRGTDDAHDAALARELLEDPKERAEHV 360

Query: 361 MLVDLGRNDLGRIAAPGTVQVERFMDVEKFSHVMHLTSRVTAQIEPGRDALDVLAATFPA 420
           MLVDLGRNDLGRIAAPGTVQVERFMDVEKFSHVMHLTSRVTAQIEPGRDALDVLAATFPA
Sbjct: 361 MLVDLGRNDLGRIAAPGTVQVERFMDVEKFSHVMHLTSRVTAQIEPGRDALDVLAATFPA 420

Query: 421 GTVSGAPKVRAMEIISEAEGLARGPYAGAIGWLGLDRDSVNLDTGITIRSLWVRDGQVHW 480
           GTVSGAPKVRAMEIISEAEGLARGPYAGAIGWLGLDRDSVNLDTGITIRSLWVRDGQVHW
Sbjct: 421 GTVSGAPKVRAMEIISEAEGLARGPYAGAIGWLGLDRDSVNLDTGITIRSLWVRDGQVHW 480

Query: 481 QAGAGIVFDSVPEMEWKECNNKAAVIRAAVTGGEYVPVNR 520
           QAGAGIVFDSVPEMEWKECNNKAAVIRAAVTGGEYVPVNR
Sbjct: 481 QAGAGIVFDSVPEMEWKECNNKAAVIRAAVTGGEYVPVNR 520


Lambda     K      H
   0.320    0.137    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1034
Number of extensions: 26
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 520
Length of database: 520
Length adjustment: 35
Effective length of query: 485
Effective length of database: 485
Effective search space:   235225
Effective search space used:   235225
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory