Align acetylglutamate kinase (EC 2.7.2.8) (characterized)
to candidate Dsui_1309 Dsui_1309 acetylglutamate kinase
Query= BRENDA::Q9HTN2 (301 letters) >FitnessBrowser__PS:Dsui_1309 Length = 293 Score = 358 bits (918), Expect = e-103 Identities = 180/290 (62%), Positives = 231/290 (79%), Gaps = 5/290 (1%) Query: 9 AQVAKVLSEALPYIRRFVGKTLVIKYGGNAMESEELKAGFARDVVLMKAVGINPVVVHGG 68 AQ A +L+EALPYI+RF G+T+V+KYGGNAM E LK FARDVVL+K VG+N VVVHGG Sbjct: 7 AQQAAILAEALPYIKRFHGRTIVVKYGGNAMTDEHLKQCFARDVVLLKLVGMNVVVVHGG 66 Query: 69 GPQIGDLLKRLSIESHFIDGMRVTDAATMDVVEMVLGGQVNKDIVNLINRHGGSAIGLTG 128 GPQI ++L R+ + FI GMRVTDA TM+VVEMVLGGQVNKD+VNLINR GG A+GLTG Sbjct: 67 GPQIENMLGRVGKKGEFIQGMRVTDAETMEVVEMVLGGQVNKDVVNLINRAGGKAVGLTG 126 Query: 129 KDAELIRAKKLTV-TRQTPEMTKPEIIDIGHVGEVTGVNVGLLNMLVKGDFIPVIAPIGV 187 KD +IRAKKL + ++ P+ ++ID+G VG++ ++ L+ L FIPVIAPIGV Sbjct: 127 KDGGMIRAKKLLLPNKENPD----DLIDVGQVGDIVQIDPSLIGNLEGAGFIPVIAPIGV 182 Query: 188 GSNGESYNINADLVAGKVAEALKAEKLMLLTNIAGLMDKQGQVLTGLSTEQVNELIADGT 247 G +GE+YNINAD+VAGKVAE LKAEKL+LLTN G++DK GQ++TG++ +Q+++++ DGT Sbjct: 183 GKDGETYNINADVVAGKVAEVLKAEKLVLLTNTPGVLDKAGQLITGITPKQIDDMVEDGT 242 Query: 248 IYGGMLPKIRCALEAVQGGVTSAHIIDGRVPNAVLLEIFTDSGVGTLISN 297 + GGMLPKI AL+A + GV S HIIDGRV +A+LLEI TD GVGT+I + Sbjct: 243 LSGGMLPKISSALDAARNGVKSVHIIDGRVEHALLLEILTDHGVGTMIKS 292 Lambda K H 0.318 0.138 0.381 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 379 Number of extensions: 19 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 301 Length of database: 293 Length adjustment: 26 Effective length of query: 275 Effective length of database: 267 Effective search space: 73425 Effective search space used: 73425 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate Dsui_1309 Dsui_1309 (acetylglutamate kinase)
to HMM TIGR00761 (argB: acetylglutamate kinase (EC 2.7.2.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00761.hmm # target sequence database: /tmp/gapView.31524.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00761 [M=231] Accession: TIGR00761 Description: argB: acetylglutamate kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-77 246.3 7.7 1.8e-77 246.0 7.7 1.1 1 lcl|FitnessBrowser__PS:Dsui_1309 Dsui_1309 acetylglutamate kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_1309 Dsui_1309 acetylglutamate kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 246.0 7.7 1.8e-77 1.8e-77 1 231 [] 27 267 .. 27 267 .. 0.96 Alignments for each domain: == domain 1 score: 246.0 bits; conditional E-value: 1.8e-77 TIGR00761 1 tiViKiGGaais..elleelakdiaklrkegiklvivHGGgpeinelleklgievefvnglRvTdketlevvemvli 75 tiV+K+GG+a++ +l++ +a+d++ l+ +g+++v+vHGGgp+i+++l ++g + ef++g+RvTd+et+evvemvl lcl|FitnessBrowser__PS:Dsui_1309 27 TIVVKYGGNAMTdeHLKQCFARDVVLLKLVGMNVVVVHGGGPQIENMLGRVGKKGEFIQGMRVTDAETMEVVEMVLG 103 69*********98889999********************************************************** PP TIGR00761 76 gkvnkelvallekhgikavGltgkDgqlltae..kldke.......dlgyvGeikkvnkelleallkagiipviasl 143 g+vnk +v+l++++g kavGltgkDg ++ a+ l ++ d+g vG+i +++++l+ +l ag+ipvia++ lcl|FitnessBrowser__PS:Dsui_1309 104 GQVNKDVVNLINRAGGKAVGLTGKDGGMIRAKklLLPNKenpddliDVGQVGDIVQIDPSLIGNLEGAGFIPVIAPI 180 ********************************652222258999********************************* PP TIGR00761 144 aldeegqllNvnaDtaAaelAaaleAekLvlLtdvaGilegdkksliseleleeieqlikqavikgGmipKveaale 220 ++ ++g+++N+naD++A+++A++l+AekLvlLt+++G+l++ + +li+ +++++i+++++ + + gGm pK+++al+ lcl|FitnessBrowser__PS:Dsui_1309 181 GVGKDGETYNINADVVAGKVAEVLKAEKLVLLTNTPGVLDK-AGQLITGITPKQIDDMVEDGTLSGGMLPKISSALD 256 *****************************************.555******************************** PP TIGR00761 221 alesgvkkvvi 231 a+++gvk+v+i lcl|FitnessBrowser__PS:Dsui_1309 257 AARNGVKSVHI 267 *********98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (231 nodes) Target sequences: 1 (293 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00 # Mc/sec: 7.61 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory