Align 3-isopropylmalate/3-methylmalate dehydrogenase; 3-isopropylmalate dehydrogenase; 3-IPM-DH; IMDH; IPMDH; Beta-IPM dehydrogenase; D-malate dehydrogenase [decarboxylating]; EC 1.1.1.85; EC 1.1.1.n5; EC 1.1.1.83 (characterized)
to candidate Dsui_3296 Dsui_3296 isocitrate dehydrogenase, NADP-dependent, prokaryotic type
Query= SwissProt::Q58130 (333 letters) >FitnessBrowser__PS:Dsui_3296 Length = 408 Score = 161 bits (408), Expect = 2e-44 Identities = 119/361 (32%), Positives = 174/361 (48%), Gaps = 60/361 (16%) Query: 7 IEGDGIGKEVVPATIQVLEAT---------GLPFEFVYA-EAGDEVYKRTGKALPEETIE 56 IEGDGIG ++ P I+V++A + + VYA E +Y + LP+ET + Sbjct: 29 IEGDGIGVDITPVMIKVVDAAVQKAYGGQKKIHWMEVYAGEKSTRIYG-ADEWLPKETFD 87 Query: 57 TALDCDAVLFGA----AGETAADVIVKLRHILDTYANIRPVKAYKGVKC--LRPDI-DYV 109 + + G G + V LR LD Y +RPV+ +KGV +P++ + V Sbjct: 88 ALKEYSVSIKGPMTTPVGGGIRSLNVALRQELDLYQCVRPVQYFKGVPSPLKQPELCNMV 147 Query: 110 IVRENTEGLYKGIE-----------------------AEIDEGITIATRVITEKACERIF 146 I RENTE +Y GIE E I + I+ + ER+ Sbjct: 148 IFRENTEDIYAGIEWAHGSEACKKVIKFLQEEMGVKKIRFPESSGIGIKPISVEGTERLV 207 Query: 147 RFAFNLARERKKMGKEGKVTCAHKANVLKLTDGLFKKIFYKVAEEY-------------- 192 R A A + + VT HK N++K T+G F+ Y +A+ Sbjct: 208 RAAIKYAIDNGRKS----VTIVHKGNIMKFTEGNFRDTAYALAKREFGGVDIDGGPWQKL 263 Query: 193 -DDIKAEDYYIDAMNMYIITKPQVFDVVVTSNLFGDILSDGAAGTVGGLGLAPSANIGDE 251 + I +D DA I+ +P +DV+ T+NL GD +SD A VGG+G+AP ANI D+ Sbjct: 264 PNGIVIKDAIADAFLQQILLRPAEYDVIATTNLNGDYISDALAAQVGGIGIAPGANISDQ 323 Query: 252 HGLFEPVHGSAPDIAGKKIANPTATILSAVLMLRYLGEYEAADKVEKALEEVLALGLTTP 311 + FE HG+AP AGK NP + ILSA +MLR+LG EAAD + K++E + + T Sbjct: 324 YACFEATHGTAPKYAGKDKVNPGSLILSAEMMLRHLGWKEAADLIIKSMEAAIGDKVVTY 383 Query: 312 D 312 D Sbjct: 384 D 384 Lambda K H 0.318 0.138 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 17 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 333 Length of database: 408 Length adjustment: 30 Effective length of query: 303 Effective length of database: 378 Effective search space: 114534 Effective search space used: 114534 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory