Align 3-isopropylmalate dehydratase small subunit 1; Alpha-IPM isomerase 1; IPMI 1; Isopropylmalate isomerase 1; EC 4.2.1.33 (characterized)
to candidate Dsui_3199 Dsui_3199 3-isopropylmalate dehydratase, small subunit
Query= SwissProt::P04787 (201 letters) >FitnessBrowser__PS:Dsui_3199 Length = 212 Score = 229 bits (585), Expect = 2e-65 Identities = 114/204 (55%), Positives = 143/204 (70%), Gaps = 8/204 (3%) Query: 3 EKFTQHTGLVVPLDAANVDTDAIIPKQFLQKVTRTGFGAHLFNDWRFLD------EKGQQ 56 + FT+ GLV PLD NVDTDAIIPKQFL+ + R+GFG + F++WR++D + ++ Sbjct: 2 QAFTKLDGLVAPLDRNNVDTDAIIPKQFLKSIKRSGFGPNAFDEWRYMDHGEPGMDNSKR 61 Query: 57 P-NPEFVLNFPEYQGASILLARENFGCGSSREHAPWALTDYGFKVVIAPSFADIFYGNSF 115 P NP FVLN YQGAS+LL R NFGCGSSREHAPWAL DYGF+VVIA SFADIF+ N F Sbjct: 62 PLNPNFVLNQQRYQGASVLLTRSNFGCGSSREHAPWALLDYGFRVVIAESFADIFFNNCF 121 Query: 116 NNQLLPVTLSDAQVDELFALVKANPGIKFEVDLEAQ-VVKAGDKTYSFKIDDFRRHCMLN 174 N +LP+ L ++D LF L + PG K VDLE Q VV+ F++D FRR C+LN Sbjct: 122 KNGILPIVLPKTEIDALFGLTEYTPGFKLVVDLEQQKVVRPDGHAIPFEVDAFRRECLLN 181 Query: 175 GLDSIGLTLQHEDAIAAYENKQPA 198 G D IGLTL+H D I A+E ++ A Sbjct: 182 GWDDIGLTLRHADKIKAFEERRRA 205 Lambda K H 0.321 0.138 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 190 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 201 Length of database: 212 Length adjustment: 21 Effective length of query: 180 Effective length of database: 191 Effective search space: 34380 Effective search space used: 34380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 45 (21.9 bits)
Align candidate Dsui_3199 Dsui_3199 (3-isopropylmalate dehydratase, small subunit)
to HMM TIGR00171 (leuD: 3-isopropylmalate dehydratase, small subunit (EC 4.2.1.33))
../bin/blast/fastacmd -i /tmp/list.8135.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.8135.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.