Align Succinyl-diaminopimelate desuccinylase; SDAP desuccinylase; N-succinyl-LL-2,6-diaminoheptanedioate amidohydrolase; EC 3.5.1.18 (characterized)
to candidate Dsui_2711 Dsui_2711 succinyl-diaminopimelate desuccinylase
Query= SwissProt::Q9JYL2 (381 letters) >FitnessBrowser__PS:Dsui_2711 Length = 383 Score = 493 bits (1270), Expect = e-144 Identities = 243/375 (64%), Positives = 286/375 (76%) Query: 2 TETQSLELAKELISRPSVTPDDRDCQKLLAERLHKIGFAAEELHFGDTKNIWLRRGTKAP 61 T +L+LA +LISR SVTP+D C L++ RL +GF E ++ G+T N+W RRG+ AP Sbjct: 8 TSDPTLDLAAQLISRRSVTPEDGGCMDLISARLKPLGFTLEAINQGNTVNLWARRGSAAP 67 Query: 62 VVCFAGHTDVVPTGPVEKWDSPPFEPAERDGRLYGRGAADMKTSIACFVTACERFVAKHP 121 +VC AGHTDVVPTGPVE+W S PF P RDG LYGRGAADMK S+A FVTA E FVA+HP Sbjct: 68 LVCLAGHTDVVPTGPVEQWASDPFTPTLRDGMLYGRGAADMKGSLAAFVTAVETFVARHP 127 Query: 122 NHQGSIALLITSDEEGDALDGTTKVVDVLKARDELIDYCIVGEPTAVDKLGDMIKNGRRG 181 HQGSIA L+TSDEEGDA DGT VV+ L+AR E ID CIVGEPT V++LGDM+KNGRRG Sbjct: 128 QHQGSIAFLLTSDEEGDATDGTVAVVEALQARGEGIDCCIVGEPTCVNRLGDMVKNGRRG 187 Query: 182 SLSGNLTVKGKQGHIAYPHLAINPVHTFAPALLELTQEVWDEGNEYFPPTSFQISNINGG 241 SLSG LTVKG QGHIAYPHLA NP+H APA+ EL WD+GNEYFPPT++Q+SNI GG Sbjct: 188 SLSGRLTVKGIQGHIAYPHLAKNPIHLAAPAIAELAATEWDQGNEYFPPTTWQVSNIRGG 247 Query: 242 TGATNVIPGELNVKFNFRFSTESTEAGLKQRVHAILDKHGVQYDLQWSCSGQPFLTQAGK 301 TGATNVIPG +++ FNFRFST ST GLK R+ A+L KHG+ YDL W+ +PFLT G Sbjct: 248 TGATNVIPGTVDILFNFRFSTASTPEGLKSRLEAVLAKHGIDYDLAWTLGAKPFLTGRGP 307 Query: 302 LTDVARAAIAETCGIEAELSTTGGTSDGRFIKAIAQELIELGPSNATIHQINENVRLNDI 361 L D A AAI E IE ELSTTGGTSDGRFI I ++IELGP NATIH+I+E V + Sbjct: 308 LVDAAMAAIREELNIETELSTTGGTSDGRFIAEICPQVIELGPVNATIHKIDECVEAAAL 367 Query: 362 PKLSAVYEGILARLL 376 P+LSA Y IL +LL Sbjct: 368 PRLSATYCRILEKLL 382 Lambda K H 0.317 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 486 Number of extensions: 13 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 381 Length of database: 383 Length adjustment: 30 Effective length of query: 351 Effective length of database: 353 Effective search space: 123903 Effective search space used: 123903 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate Dsui_2711 Dsui_2711 (succinyl-diaminopimelate desuccinylase)
to HMM TIGR01246 (dapE: succinyl-diaminopimelate desuccinylase (EC 3.5.1.18))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01246.hmm # target sequence database: /tmp/gapView.13869.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01246 [M=370] Accession: TIGR01246 Description: dapE_proteo: succinyl-diaminopimelate desuccinylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 5e-166 538.2 0.0 5.7e-166 538.0 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_2711 Dsui_2711 succinyl-diaminopimela Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_2711 Dsui_2711 succinyl-diaminopimelate desuccinylase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 538.0 0.0 5.7e-166 5.7e-166 2 370 .] 13 381 .. 12 381 .. 0.99 Alignments for each domain: == domain 1 score: 538.0 bits; conditional E-value: 5.7e-166 TIGR01246 2 lelakeLisrksvtPndagaqeliaerLkklgfeieilefedtknlwatrgteepvlvfaGhtDvvPaGelekWssd 78 l+la +Lisr+svtP+d g+++li +rLk lgf+ e ++ ++t nlwa+rg +p +++aGhtDvvP+G++e+W sd lcl|FitnessBrowser__PS:Dsui_2711 13 LDLAAQLISRRSVTPEDGGCMDLISARLKPLGFTLEAINQGNTVNLWARRGSAAPLVCLAGHTDVVPTGPVEQWASD 89 6899************************************************************************* PP TIGR01246 79 pfepeerdGklygrGaaDmkgslaafvvaaerfvkknadhkGslsllitsDeegeaidGtkkvvetlkerdelidya 155 pf+p+ rdG+lygrGaaDmkgslaafv+a+e fv+++++h+Gs+++l+tsDeeg+a dGt++vve l++r e id + lcl|FitnessBrowser__PS:Dsui_2711 90 PFTPTLRDGMLYGRGAADMKGSLAAFVTAVETFVARHPQHQGSIAFLLTSDEEGDATDGTVAVVEALQARGEGIDCC 166 ***************************************************************************** PP TIGR01246 156 vvgePssvkklGDvikiGrrGsitgklkikGiqGhvaYPhkaenPvhkavpvlkeliaiklDeGneffppsslqian 232 +vgeP++v++lGD++k+GrrGs++g+l++kGiqGh+aYPh+a+nP+h a+p+++el+a+++D+Gne+fpp+ q++n lcl|FitnessBrowser__PS:Dsui_2711 167 IVGEPTCVNRLGDMVKNGRRGSLSGRLTVKGIQGHIAYPHLAKNPIHLAAPAIAELAATEWDQGNEYFPPTTWQVSN 243 ***************************************************************************** PP TIGR01246 233 ieagtgasnviPgelkvkfnlrfssevseeelkskvekildkhkldYelewklsgepfltkegklikkvaeaieevl 309 i++gtga+nviPg +++ fn+rfs+ ++ e lks++e++l kh++dY+l w+l ++pflt +g l++++++ai+e l lcl|FitnessBrowser__PS:Dsui_2711 244 IRGGTGATNVIPGTVDILFNFRFSTASTPEGLKSRLEAVLAKHGIDYDLAWTLGAKPFLTGRGPLVDAAMAAIREEL 320 ***************************************************************************** PP TIGR01246 310 kkkpelstsGGtsDarfiaklgaevvelGlvndtihkvneavkiedleklsevyeklleel 370 ++++elst+GGtsD+rfia++ +v+elG+vn+tihk++e+v+ + l +ls+ y ++le+l lcl|FitnessBrowser__PS:Dsui_2711 321 NIETELSTTGGTSDGRFIAEICPQVIELGPVNATIHKIDECVEAAALPRLSATYCRILEKL 381 *********************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (370 nodes) Target sequences: 1 (383 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.73 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory