Align [LysW]-aminoadipate semialdehyde transaminase; EC 2.6.1.- (uncharacterized)
to candidate Dsui_0023 Dsui_0023 acetylornithine/succinylornithine aminotransferase
Query= curated2:Q5SHH5 (395 letters) >FitnessBrowser__PS:Dsui_0023 Length = 396 Score = 225 bits (573), Expect = 2e-63 Identities = 138/387 (35%), Positives = 210/387 (54%), Gaps = 24/387 (6%) Query: 23 VYNKHDLLIVRGQGARVWDAEGNEYIDCVGGYGVANLGHGNPEVVEAVKRQAETLMAMPQ 82 + + L+ G+G+ + D +G Y+D V G+ V LGHG+P +VEA+ QA L+ Sbjct: 17 ITQRPQLVFAEGRGSWLVDQQGKRYLDFVQGWAVNCLGHGHPAIVEALASQAGKLIN--- 73 Query: 83 TLPTPMRGEFYRTLTAILPPEL------NRVFPVNSGTEANEAALKFARA-----HTGRK 131 P+P FY + L L +RVF ++G EANE A+K AR G Sbjct: 74 --PSPA---FYNEPSLKLAAGLAAHSCFDRVFFASTGAEANEGAIKLARKWGQKHKGGAH 128 Query: 132 KFVAAMRGFSGRTMGSLSVTWEPKYREPFLPLVEPVEFIPYNDVEALKRAVDEETAAVIL 191 + + GF GRT+ ++S + +P + F P V ND++++ ++E T A++L Sbjct: 129 EIITFAGGFHGRTLATMSASGKPGWDTLFAPQVPGFPKAQLNDLDSVAALINERTVAIML 188 Query: 192 EPVQGEGGVRPATPEFLRAAREITQEKGALLILDEIQTGMGRTGKRFAFEHFGIVPDILT 251 EP+QGEGGV PA+ EFL+ R+I ++G LLI+DE+QTGMGRTGK FA +H GI PDI+T Sbjct: 189 EPIQGEGGVVPASAEFLQLLRQICDDRGLLLIVDEVQTGMGRTGKLFAHQHAGIEPDIMT 248 Query: 252 LAKALGGGVPLGAAVMREEVARSMPKGGHGTTFGGNPLAMAAGVAAIRYLERTRLWERAA 311 L K +GGGVPL A + +E V G G T+ GNPL A G A + L A Sbjct: 249 LGKGIGGGVPLSALLAKESVC-CFEAGDQGGTYNGNPLMTAVGAAVLEVLTAPGFLAEVA 307 Query: 312 ELGPWFMEKLRAIPSP-KIREVRGMGLMVGLELKEKAAPYIARLEKE---HRVLALQAGP 367 G + L+ + +R RG GL+ L L ++ P I +E +L P Sbjct: 308 AKGEYLGAGLQRLSDRLGLRGERGQGLLRALLLADERGPAIVEAARERGPEGLLLNAPRP 367 Query: 368 TVIRFLPPLVIEKEDLERVVEAVRAVL 394 ++RF+P L + +E++++++ + +L Sbjct: 368 HLLRFMPSLTVSREEIDQMLAWLEELL 394 Lambda K H 0.319 0.137 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 422 Number of extensions: 26 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 395 Length of database: 396 Length adjustment: 31 Effective length of query: 364 Effective length of database: 365 Effective search space: 132860 Effective search space used: 132860 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory