Align glutamate 5-kinase (EC 2.7.2.11) (characterized)
to candidate Dsui_0166 Dsui_0166 glutamate 5-kinase
Query= BRENDA::P0A7B5 (367 letters) >FitnessBrowser__PS:Dsui_0166 Length = 377 Score = 307 bits (787), Expect = 3e-88 Identities = 168/360 (46%), Positives = 231/360 (64%), Gaps = 2/360 (0%) Query: 7 LVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAAGHRIVIVTSGAIAAGREHLGYPELP 66 LVVK+G++++T L+ A I E RQ A+L G ++V+V+SGAIA G + LG+ + P Sbjct: 14 LVVKVGSALVTNNGAGLDLAAIHEWARQIAELRHNGKQVVLVSSGAIACGMQRLGWQKRP 73 Query: 67 ATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDTLRALLD 126 + Q AAVGQ L Q++E FS +G+H Q+LLT D+ DR+R+LNAR TL LL+ Sbjct: 74 KAVHELQAAAAVGQMGLAQVYESAFSAHGLHTAQILLTHDDLADRKRYLNARATLTTLLE 133 Query: 127 NNIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQKGLYTADPRSNPQAE 186 +VP+INEND V T EIK GDND L AL A L AD L++LTDQ GL+TADPR +P A Sbjct: 134 LGVVPIINENDTVVTDEIKFGDNDTLGALVANLVEADCLIILTDQPGLFTADPRKDPSAT 193 Query: 187 LIKDVYGIDDALRAIAGDSVSGLGTGGMSTKLQAADVACRAGIDTIIAAGSKPGVIGDVM 246 LI D +L A+AG + + +GTGGM TK+ AA A R+G DT+IA+G + + + Sbjct: 194 LITSARAGDPSLEAMAGGAGTQIGTGGMITKVLAAKRAARSGADTVIASGREKSPLTRLA 253 Query: 247 EGISVGTLFHAQATPLENRKRWIFG-APPAGEITVDEGATAAILERGSSLLPKGIKSVTG 305 G SVGTL A P+ RK+W+ AG++T+D+GA A L +G SLLP G++ V G Sbjct: 254 TGESVGTLLVADTLPMTARKQWLADHLQLAGKLTLDQGAIQA-LRQGKSLLPVGVREVHG 312 Query: 306 NFSRGEVIRICNLEGRDIAHGVSRYNSDALRRIAGHHSQEIDAILGYEYGPVAVHRDDMI 365 +F RG + + GR+IA G+ Y S +R IA H S +I+ ILGY P +HRD+M+ Sbjct: 313 DFERGAAVACLDESGREIARGLCNYGSSEVRLIAKHSSSDIEDILGYMEEPELIHRDNMV 372 Lambda K H 0.318 0.135 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 366 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 367 Length of database: 377 Length adjustment: 30 Effective length of query: 337 Effective length of database: 347 Effective search space: 116939 Effective search space used: 116939 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate Dsui_0166 Dsui_0166 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01027.hmm # target sequence database: /tmp/gapView.18774.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01027 [M=363] Accession: TIGR01027 Description: proB: glutamate 5-kinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-137 443.6 0.5 3.3e-137 443.4 0.5 1.0 1 lcl|FitnessBrowser__PS:Dsui_0166 Dsui_0166 glutamate 5-kinase Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0166 Dsui_0166 glutamate 5-kinase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 443.4 0.5 3.3e-137 3.3e-137 2 362 .. 13 372 .. 12 373 .. 0.99 Alignments for each domain: == domain 1 score: 443.4 bits; conditional E-value: 3.3e-137 TIGR01027 2 riVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaekQalaaVGQgr 78 r+VvK+Gs+++t++ l+++ ++e ++q+a+l+++G++vv+vsSGa+a G+++Lg ++rpk ++e Qa+aaVGQ lcl|FitnessBrowser__PS:Dsui_0166 13 RLVVKVGSALVTNNGAGLDLAAIHEWARQIAELRHNGKQVVLVSSGAIACGMQRLGWQKRPKAVHELQAAAAVGQMG 89 79************999************************************************************ PP TIGR01027 79 LmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtvaveeikfGDNDtLsalvaal 155 L + ye++fs +gl++aQiLLt++dl++r+rylNar+tl++llelgvvpi+NENDtv ++eikfGDNDtL alva+l lcl|FitnessBrowser__PS:Dsui_0166 90 LAQVYESAFSAHGLHTAQILLTHDDLADRKRYLNARATLTTLLELGVVPIINENDTVVTDEIKFGDNDTLGALVANL 166 ***************************************************************************** PP TIGR01027 156 veAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgssvGTGGmrtKleaaelAsragveviiasg 232 veAd L++ltd+ gL++adpr++p A+li ++ + +l+a+ag++g+++GTGGm tK+ aa+ A+r+g +++iasg lcl|FitnessBrowser__PS:Dsui_0166 167 VEADCLIILTDQPGLFTADPRKDPSATLITSARAGDPSLEAMAGGAGTQIGTGGMITKVLAAKRAARSGADTVIASG 243 ***************************************************************************** PP TIGR01027 233 ekpekiadlledaavgtlfeakkkklknrkqwilaaseakGkiivdegaeeallekgksLlpagvvevegnFsrgev 309 ++++ +++l+ +++vgtl+ a + + +rkqw++ +++ +Gk+++d+ga +al++ gksLlp+gv ev+g+F+rg + lcl|FitnessBrowser__PS:Dsui_0166 244 REKSPLTRLATGESVGTLLVADTLPMTARKQWLADHLQLAGKLTLDQGAIQALRQ-GKSLLPVGVREVHGDFERGAA 319 *****************************************************98.********************* PP TIGR01027 310 veilaeegqeigkglvnysseelekikglkseeiedvLgyekkeevvhrdnlv 362 v +l+e+g+ei++gl ny s+e++ i++++s++ied+Lgy ++ e +hrdn+v lcl|FitnessBrowser__PS:Dsui_0166 320 VACLDESGREIARGLCNYGSSEVRLIAKHSSSDIEDILGYMEEPELIHRDNMV 372 ***************************************************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (363 nodes) Target sequences: 1 (377 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 11.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory