Align Phosphoserine phosphatase ThrH; PSP; PSPase; EC 3.1.3.3 (characterized)
to candidate Dsui_0761 Dsui_0761 phosphoserine phosphatase/homoserine phosphotransferase
Query= SwissProt::Q9I2Y2 (205 letters) >FitnessBrowser__PS:Dsui_0761 Length = 202 Score = 276 bits (705), Expect = 2e-79 Identities = 139/201 (69%), Positives = 159/201 (79%) Query: 1 MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDI 60 M+I CLDLEGVLVPEIWI FAE+TGI L+ TTR+ P+YDVLM+ RL IL +HGL L DI Sbjct: 1 MQIVCLDLEGVLVPEIWIEFAERTGIPELRRTTREEPNYDVLMQYRLGILKQHGLGLPDI 60 Query: 61 QEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSD 120 Q+VIA + PL GA EFV+WLR RFQVVILSDTFYEF+ PLM+QLGFPTL CHKLE D Sbjct: 61 QKVIAEMGPLPGAKEFVEWLRPRFQVVILSDTFYEFAMPLMQQLGFPTLFCHKLEADAQG 120 Query: 121 RVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFP 180 +V Y LR + K+++V FK L ++VIA+GDSYNDTTML EAHAGILF PENVIREFP Sbjct: 121 FLVNYHLRMPNQKQEAVKRFKELNFKVIASGDSYNDTTMLGEAHAGILFCPPENVIREFP 180 Query: 181 QFPAVHTYEDLKREFLKASSR 201 QFP V YE LK E LKAS R Sbjct: 181 QFPVVKDYEALKGEILKASER 201 Lambda K H 0.323 0.140 0.408 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 179 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 205 Length of database: 202 Length adjustment: 21 Effective length of query: 184 Effective length of database: 181 Effective search space: 33304 Effective search space used: 33304 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 45 (21.9 bits)
Align candidate Dsui_0761 Dsui_0761 (phosphoserine phosphatase/homoserine phosphotransferase)
to HMM TIGR02137 (thrH: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein (EC 3.1.3.3))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR02137.hmm # target sequence database: /tmp/gapView.25966.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR02137 [M=203] Accession: TIGR02137 Description: HSK-PSP: phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.9e-99 315.2 0.0 8.8e-99 315.1 0.0 1.0 1 lcl|FitnessBrowser__PS:Dsui_0761 Dsui_0761 phosphoserine phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PS:Dsui_0761 Dsui_0761 phosphoserine phosphatase/homoserine phosphotransferase # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 315.1 0.0 8.8e-99 8.8e-99 1 201 [. 1 201 [. 1 202 [] 0.99 Alignments for each domain: == domain 1 score: 315.1 bits; conditional E-value: 8.8e-99 TIGR02137 1 qevvtldlegvlvpeiwiavaektgiddlklttrdipdydvlmkqrlkileeenlklsdiqeviatlkllegavefv 77 +++v+ldlegvlvpeiwi +ae+tgi +l+ ttr+ p+ydvlm+ rl il++++l l diq+via++++l ga+efv lcl|FitnessBrowser__PS:Dsui_0761 1 MQIVCLDLEGVLVPEIWIEFAERTGIPELRRTTREEPNYDVLMQYRLGILKQHGLGLPDIQKVIAEMGPLPGAKEFV 77 689************************************************************************** PP TIGR02137 78 dtlreeaqvvilsdtfqefaqplmkqlgfptllchklvvedsdrvkgyqlrqkdqkrkvvkalkelyykviaagdsy 154 ++lr ++qvvilsdtf+efa plm+qlgfptl+chkl+ + ++ y+lr+ +qk+++vk +kel++kvia+gdsy lcl|FitnessBrowser__PS:Dsui_0761 78 EWLRPRFQVVILSDTFYEFAMPLMQQLGFPTLFCHKLEADAQGFLVNYHLRMPNQKQEAVKRFKELNFKVIASGDSY 154 ***************************************************************************** PP TIGR02137 155 ndttmlkeadkgilfhapesvvaefpqleavktyeelkdkflkasdr 201 ndttml ea++gilf+ pe+v++efpq++ vk ye lk ++lkas+r lcl|FitnessBrowser__PS:Dsui_0761 155 NDTTMLGEAHAGILFCPPENVIREFPQFPVVKDYEALKGEILKASER 201 ********************************************987 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (203 nodes) Target sequences: 1 (202 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 5.43 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory