Align Prephenate dehydrogenase protein; EC 1.3.1.12 (characterized, see rationale)
to candidate Dsui_1941 Dsui_1941 prephenate dehydrogenase
Query= uniprot:D8IR44_HERSS (295 letters) >FitnessBrowser__PS:Dsui_1941 Length = 290 Score = 327 bits (837), Expect = 3e-94 Identities = 165/283 (58%), Positives = 206/283 (72%) Query: 2 FKKVVIFGVGLIGGSFALALRRAGQAAHIVGVGRSLQSLERARELGIIDAVATDAASAVQ 61 F KVVIFGVGLIGGSFAL LR AG +VG GRS +SL++A +LG+ID + A + Sbjct: 4 FNKVVIFGVGLIGGSFALGLRAAGAVEEVVGFGRSPKSLQQALDLGVIDRAGINPAHELS 63 Query: 62 GADLILVAAPVAQTGPILASIAPHLEPQAIVTDAGSTKSDVVAAARMALGDRIVQFIPAH 121 ADL+L+A PV Q I+A I P+L P+ +VTD GSTK DVVAAAR A G+RI QF+PAH Sbjct: 64 DADLVLLATPVGQMPEIMARIVPYLGPETVVTDGGSTKGDVVAAARAAFGERIGQFVPAH 123 Query: 122 PIAGREKHGPEAALAELYEGKKVVITALPENDAADVEIVAAAWRACGAVIHRLSPQEHDA 181 PIAG E G AA A+LY +KVV+T LPEN +V V +AW CGA I+ L+P EHD Sbjct: 124 PIAGAENSGAAAARADLYRERKVVLTPLPENSVLNVAKVRSAWEWCGAQIYELTPAEHDR 183 Query: 182 VFASVSHLPHVLAFALVDDIAAKPHAATLFQYAASGFRDFTRIAASSPEMWRDITLANRD 241 VFA+VSHLPH+L+FALV D+A + + F +AASGFRDFTRIAAS PEMWRDI LAN+D Sbjct: 184 VFAAVSHLPHLLSFALVHDLAVRENKELFFTFAASGFRDFTRIAASHPEMWRDICLANKD 243 Query: 242 ALLTEVDAYLLQLQNIRAMIAAGDGPGIEKIYASAQHARQQWA 284 ALL E+D+Y QL + +AAGDG +E+I+ +A+ AR+ WA Sbjct: 244 ALLLELDSYRAQLDELHQALAAGDGRRLEEIFDTARTARRDWA 286 Lambda K H 0.320 0.132 0.376 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 273 Number of extensions: 12 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 295 Length of database: 290 Length adjustment: 26 Effective length of query: 269 Effective length of database: 264 Effective search space: 71016 Effective search space used: 71016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory