Align acetylornithine deacetylase (EC 3.5.1.16) (characterized)
to candidate 5207679 Shew_0201 acetylornithine deacetylase (RefSeq)
Query= ecocyc::ACETYLORNDEACET-MONOMER (383 letters) >lcl|FitnessBrowser__PV4:5207679 Shew_0201 acetylornithine deacetylase (RefSeq) Length = 386 Score = 461 bits (1185), Expect = e-134 Identities = 219/382 (57%), Positives = 284/382 (74%), Gaps = 1/382 (0%) Query: 1 MKNKLPPFIEIYRALIATPSISATEEALDQSNADLITLLADWFKDLGFNVEVQPVPGTRN 60 M P + +R LIATPSISA E LD SN ++TLL+ W DLGF+ ++Q VP TR Sbjct: 1 MMKTFPDIKQSFRELIATPSISALEAELDMSNQGVVTLLSQWLTDLGFDCQMQAVPDTRG 60 Query: 61 KFNMLASIGQGAGGLLLAGHTDTVPFDDGRWTRDPFTLTEHDGKLYGLGTADMKGFFAFI 120 K N+LA IGQG GGLLLAGHTDTVPFD+GRW++DPFTLTE D + YGLG+ DMKGFFA + Sbjct: 61 KHNLLAKIGQGRGGLLLAGHTDTVPFDEGRWSQDPFTLTEKDNRWYGLGSCDMKGFFALV 120 Query: 121 LDALRDVDVTKLKKPLYILATADEETSMAGARYFAETTALRPDCAIIGEPTSLQPVRAHK 180 ++A+R + +PLYILA+ADEET+M GA+ FA++ A+ P+ A+IGEPT L+PV HK Sbjct: 121 IEAVRQMPTQDFVRPLYILASADEETTMNGAKAFAQSKAIAPEYALIGEPTGLKPVYMHK 180 Query: 181 GHISNAIRIQGQSGHSSDPARGVNAIELMHDAIGHILQLRDNLKERYHYEAFTVPYPTLN 240 GH++ IRI G+SGHSSDPA+G+NAIE+MH IG +L+L+ +L E Y EAF+VPYPT+N Sbjct: 181 GHLAQGIRITGRSGHSSDPAKGLNAIEIMHQVIGQLLKLKQHLAEHYREEAFSVPYPTMN 240 Query: 241 LGHIHGGDASNRICACCELHMDIRPLPGMTLNELNGLLNDALAPVSERWPGRLTVDELHP 300 GHIHGGDA+NRIC CC+LH+DIRPLPG+ L L LL LA +S+R+PG +++ +L+P Sbjct: 241 FGHIHGGDAANRICGCCDLHLDIRPLPGLPLEVLEQLLTQYLAELSQRYPGSISISQLYP 300 Query: 301 PIPGYECPPNHQLVEVVEKLLGAKTEVVNYCTEAPFIQTL-CPTLVLGPGSINQAHQPDE 359 + + Q ++V +L EVVNY TEAP+IQ L C TLV GPGSI QAHQPDE Sbjct: 301 GSQPFAGQADAQWSQLVAQLSNQAPEVVNYATEAPYIQQLGCQTLVWGPGSIEQAHQPDE 360 Query: 360 YLETRFIKPTRELITQVIHHFC 381 YL+T +I T +L+ Q+I+H C Sbjct: 361 YLDTAYINKTVDLLKQLIYHAC 382 Lambda K H 0.320 0.139 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 470 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 383 Length of database: 386 Length adjustment: 30 Effective length of query: 353 Effective length of database: 356 Effective search space: 125668 Effective search space used: 125668 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
Align candidate 5207679 Shew_0201 (acetylornithine deacetylase (RefSeq))
to HMM TIGR01892 (argE: acetylornithine deacetylase (ArgE) (EC 3.5.1.16))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01892.hmm # target sequence database: /tmp/gapView.15554.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01892 [M=365] Accession: TIGR01892 Description: AcOrn-deacetyl: acetylornithine deacetylase (ArgE) Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8e-137 442.1 0.0 9.2e-137 441.9 0.0 1.0 1 lcl|FitnessBrowser__PV4:5207679 Shew_0201 acetylornithine deacet Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5207679 Shew_0201 acetylornithine deacetylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 441.9 0.0 9.2e-137 9.2e-137 3 365 .] 12 378 .. 10 378 .. 0.99 Alignments for each domain: == domain 1 score: 441.9 bits; conditional E-value: 9.2e-137 TIGR01892 3 lakLvafdsvsar......snvdlieyvedyleelgvavevlpvadgaeksnllaviGpkegagglvlsGhtDvvPvd 74 +++L+a++s+sa+ sn+ +++++ ++l +lg+ + + v+d++ k nlla iG +g+ggl+l+GhtD+vP+d lcl|FitnessBrowser__PV4:5207679 12 FRELIATPSISALeaeldmSNQGVVTLLSQWLTDLGFDCQMQAVPDTRGKHNLLAKIG--QGRGGLLLAGHTDTVPFD 87 789*********999*******************************************..9***************** PP TIGR01892 75 eaaWtsDpfrLtekdgrLYgrGtaDmkGFlalvLaavpdlaaakLkkPlhlvlsaDeevglaGakkliealarrpala 152 e++W++Dpf+Ltekd+r Yg+G++DmkGF+alv++av+++ +++ +Pl++++saDee+++ Gak +++ a p+ a lcl|FitnessBrowser__PV4:5207679 88 EGRWSQDPFTLTEKDNRWYGLGSCDMKGFFALVIEAVRQMPTQDFVRPLYILASADEETTMNGAKAFAQSKAIAPEYA 165 ****************************************************************************** PP TIGR01892 153 ivGePtslvavRahkGkasakvtvrGreghssrpdrGvsaielaakllarlvaladklkredleeaFtppyatlniGt 230 ++GePt+l++v hkG+ ++ ++++Gr+ghss+p++G++aie +++++++l++l+++l +++ eeaF +py+t+n G+ lcl|FitnessBrowser__PV4:5207679 166 LIGEPTGLKPVYMHKGHLAQGIRITGRSGHSSDPAKGLNAIEIMHQVIGQLLKLKQHLAEHYREEAFSVPYPTMNFGH 243 ****************************************************************************** PP TIGR01892 231 vkGGkavniiaaaCelvlelRpipGmdpeellallekiaeevkekapgfevkveelsatpaleleedaelvallekla 308 ++GG+a n+i+++C l+l++Rp+pG+++e l +ll++ ++e++++ pg ++ + + ++ ++da+ +l+++l+ lcl|FitnessBrowser__PV4:5207679 244 IHGGDAANRICGCCDLHLDIRPLPGLPLEVLEQLLTQYLAELSQRYPGSISISQLYPGSQPFAGQADAQWSQLVAQLS 321 ****************************************************************************** PP TIGR01892 309 GaaaevvsygteagllqelGieavvlGPGdidqahqpdeYveieelkrcrallerlv 365 +a+evv+y+tea+++q+lG++++v GPG+i+qahqpdeY+++ ++++ +ll++l+ lcl|FitnessBrowser__PV4:5207679 322 NQAPEVVNYATEAPYIQQLGCQTLVWGPGSIEQAHQPDEYLDTAYINKTVDLLKQLI 378 *****************************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (365 nodes) Target sequences: 1 (386 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.33 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory