Align argininosuccinate synthase (EC 6.3.4.5) (characterized)
to candidate 5207683 Shew_0205 argininosuccinate synthase (RefSeq)
Query= BRENDA::A4I066 (418 letters) >lcl|FitnessBrowser__PV4:5207683 Shew_0205 argininosuccinate synthase (RefSeq) Length = 407 Score = 418 bits (1075), Expect = e-121 Identities = 209/395 (52%), Positives = 270/395 (68%), Gaps = 3/395 (0%) Query: 15 RVVLAYSGGLDTSVIIPWLKENYDY-EVIACCANVGQGAGEIDGLEEKAKKSGASKLYLL 73 +VVLAYSGGLDTS IIPWLKE YD E++A CA+VGQG E++GL EKA SGAS+ Y++ Sbjct: 12 KVVLAYSGGLDTSAIIPWLKETYDNCEIVAFCADVGQGEAELEGLHEKAIASGASECYIV 71 Query: 74 DLREEYVTDYIFPTLKAGATYEGKYMLGTSHARPLIAKHLVEVAHKEGAVAICHGATGKG 133 DL+EE V DYI+PT+ GA YEG Y+LGTS ARP+IAK VEVA K GA A+CHG TGKG Sbjct: 72 DLKEELVADYIYPTIATGAIYEGTYLLGTSMARPIIAKAQVEVARKVGADAVCHGCTGKG 131 Query: 134 NDQVRFELAVMALDPSLKCVAPWREWNIKSREDAIDYAEAHGVPVPCTKSDLYSRDRNLW 193 NDQVRFE AL P L +APWREW++ SRED +DY + + + +YSRD N W Sbjct: 132 NDQVRFEGCFAALAPDLTVIAPWREWSMVSREDLLDYLAERNIKTTASATKIYSRDANAW 191 Query: 194 HISHEGMDLEDPANEPAYARLLRLCNTVEKAPDEAEYVTVQFEKGIPVAVNGRKMSSVEL 253 HISHEG +LEDP NEP+ + + E APDE EYV+V+ E G VNG+ + Sbjct: 192 HISHEGGELEDPWNEPS-KEVWTMTVAPEDAPDEPEYVSVEMEAGRITKVNGQSYTPYGA 250 Query: 254 VEELNALGGKHAIGIEDIVEDRLVGMKSRGVYETPAGTILYKALDMLESLCLDRDTQSFK 313 + LN + G H +G DI E+RLVGMKSRG YETP GT+++ AL +E L LD+ ++ ++ Sbjct: 251 LMALNEIAGAHGVGRIDITENRLVGMKSRGCYETPGGTVMFAALRAIEELVLDKTSREWR 310 Query: 314 RQSAVRFSELVYDGKWFTPLRESMSAMFDQMAETVTGEATLKLYKGNLVPAGAQSPYSLY 373 Q + + LVYDG+WFTPL ES+ +A + GE LKLYKG +SP SLY Sbjct: 311 EQVGAKMAHLVYDGRWFTPLCESLLGASQPLANLLNGEVVLKLYKGQAQAVKKRSPNSLY 370 Query: 374 NKNIASFGDSQHLYNHHDAEGFIRLFGLPLRVRSM 408 ++ A+FG+ + +YN DAEGFIRL+ L R+R++ Sbjct: 371 SEEFATFGEDE-VYNQKDAEGFIRLYSLASRIRAL 404 Lambda K H 0.317 0.134 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 479 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 418 Length of database: 407 Length adjustment: 31 Effective length of query: 387 Effective length of database: 376 Effective search space: 145512 Effective search space used: 145512 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 5207683 Shew_0205 (argininosuccinate synthase (RefSeq))
to HMM TIGR00032 (argG: argininosuccinate synthase (EC 6.3.4.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00032.hmm # target sequence database: /tmp/gapView.23437.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00032 [M=394] Accession: TIGR00032 Description: argG: argininosuccinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.1e-142 458.9 0.0 1e-141 458.7 0.0 1.0 1 lcl|FitnessBrowser__PV4:5207683 Shew_0205 argininosuccinate synt Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5207683 Shew_0205 argininosuccinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 458.7 0.0 1e-141 1e-141 1 388 [. 12 401 .. 12 407 .] 0.98 Alignments for each domain: == domain 1 score: 458.7 bits; conditional E-value: 1e-141 TIGR00032 1 kvvlaysGGlDtsvalklleek..gaeviavtvdvGqpeedldaieekalklGaekayviDareefvkdylfaaiqan 76 kvvlaysGGlDts+++++l+e ++e++a+++dvGq+e++l+ +eka++ Ga + y++D +ee+v+dy+ ++i ++ lcl|FitnessBrowser__PV4:5207683 12 KVVLAYSGGLDTSAIIPWLKETydNCEIVAFCADVGQGEAELEGLHEKAIASGASECYIVDLKEELVADYIYPTIATG 89 8********************98788**************************************************** PP TIGR00032 77 avyegkYllstaLaRpliakklvevakkegaeavahGctgKGnDqvRFelsilllnpdlkviaPvreleli.Reeeie 153 a+yeg+Yll+t++aRp+iak++veva+k ga+av hGctgKGnDqvRFe + +l+pdl viaP+re+ ++ Re++++ lcl|FitnessBrowser__PV4:5207683 90 AIYEGTYLLGTSMARPIIAKAQVEVARKVGADAVCHGCTGKGNDQVRFEGCFAALAPDLTVIAPWREWSMVsREDLLD 167 *********************************************************************998****** PP TIGR00032 154 yaaekGievpvekekaysiDenllgrsiEageLEdpsteppediyelvkdpiektedepevveieFekGvPvalnges 231 y+ae+ i++ ++ k ys D n +++s+E+geLEdp+ ep ++++++++ p++++ depe+v +e e G ++ng+s lcl|FitnessBrowser__PV4:5207683 168 YLAERNIKTTASATKIYSRDANAWHISHEGGELEDPWNEPSKEVWTMTVAPEDAP-DEPEYVSVEMEAGRITKVNGQS 244 *************************************************887777.********************** PP TIGR00032 232 lepvelilkaneiagkhGvGriDivEdRiiglKsReiYEapalllLikAhkdLetlvltkdvlefkeiveekyseliY 309 ++p + ++neiag+hGvGriDi E+R++g+KsR++YE+p+ +++ A +++e+lvl+k +e++e v+ k+++l+Y lcl|FitnessBrowser__PV4:5207683 245 YTPYGALMALNEIAGAHGVGRIDITENRLVGMKSRGCYETPGGTVMFAALRAIEELVLDKTSREWREQVGAKMAHLVY 322 ****************************************************************************** PP TIGR00032 310 kGlwfdplaealdalikktqervtGtvrvklfkGnaivigrkseyslYdeelvsfekdkefdqkdaiGfikirglqik 387 G+wf pl+e l + + ++ ++G+v +kl+kG+a + ++s++slY+ee ++f +d+ ++qkda+Gfi++++l + lcl|FitnessBrowser__PV4:5207683 323 DGRWFTPLCESLLGASQPLANLLNGEVVLKLYKGQAQAVKKRSPNSLYSEEFATFGEDEVYNQKDAEGFIRLYSLASR 400 *************************************************************************99876 PP TIGR00032 388 v 388 + lcl|FitnessBrowser__PV4:5207683 401 I 401 5 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (394 nodes) Target sequences: 1 (407 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.02s 00:00:00.03 Elapsed: 00:00:00.02 # Mc/sec: 7.51 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory