Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate 5210398 Shew_2839 carbamoyl phosphate synthase small subunit (RefSeq)
Query= SwissProt::Q9LVW7 (430 letters) >FitnessBrowser__PV4:5210398 Length = 390 Score = 350 bits (898), Expect = e-101 Identities = 177/380 (46%), Positives = 237/380 (62%), Gaps = 9/380 (2%) Query: 57 NARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNT 116 +A LVLEDG+++ + GA G + E+VFNTS+TGYQEILTDPSY+ Q V +T P IGNT Sbjct: 13 SALLVLEDGTVFSGTAIGADGLAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNT 72 Query: 117 GVNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLR 176 G N +D ES GL+IR+L + SN+R ++L+DYL +++G+ D+DTR +TR LR Sbjct: 73 GTNSEDTESEAVHACGLIIRDLPLLASNFRNEQSLSDYLKSNNVVGIADIDTRKLTRILR 132 Query: 177 EDGSLIGVLSTEQSKTDDELLQMSRSWDIVGIDLISDVSCKSPYEWVDKTNAEWDF---- 232 E G+ G + L + G+DL +V+ + Y+W + W Sbjct: 133 EKGAQAGAILVGDMDEAKALAAAKAFPGLKGMDLAKEVTTQKQYQW---RSGSWRLVGGL 189 Query: 233 -NTNSRDGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNG 291 + YKV+AYD+G+K+NILR L GC +TVVP+ PAAE L MNPDGI SNG Sbjct: 190 PSDTPESELKYKVVAYDYGVKRNILRMLVDRGCDVTVVPAQTPAAEVLAMNPDGIFLSNG 249 Query: 292 PGDPSAVPYAVETVKELLGK-VPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNR 350 PGDP YA+E ++ L +P++GIC+GHQLL A G KT KMKFGHHG NHPV N Sbjct: 250 PGDPEPCDYAIEAIQAFLKTDIPLFGICLGHQLLALASGAKTLKMKFGHHGANHPVSNLE 309 Query: 351 TGQVEISAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPH 410 G V I++QNH +A D SLP V+VTH +L DGS G+ + S Q HPEASPGPH Sbjct: 310 KGNVMITSQNHGFAADETSLPANVKVTHKSLFDGSLQGIHLTDKPAFSFQGHPEASPGPH 369 Query: 411 DSDNAFREFIELMKRSKQSS 430 D+ F FIEL++ + ++ Sbjct: 370 DAAPLFDHFIELIEEYRHNA 389 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 464 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 390 Length adjustment: 31 Effective length of query: 399 Effective length of database: 359 Effective search space: 143241 Effective search space used: 143241 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate 5210398 Shew_2839 (carbamoyl phosphate synthase small subunit (RefSeq))
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.21792.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-154 500.5 0.0 1.4e-154 500.3 0.0 1.0 1 lcl|FitnessBrowser__PV4:5210398 Shew_2839 carbamoyl phosphate sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210398 Shew_2839 carbamoyl phosphate synthase small subunit (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 500.3 0.0 1.4e-154 1.4e-154 1 360 [. 14 383 .. 14 384 .. 0.97 Alignments for each domain: == domain 1 score: 500.3 bits; conditional E-value: 1.4e-154 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkglvv 78 a lvledGtvf+g+++ga++ +vGevvFnTsmtGYqEiltDpsY++qiv+ltyp+ign+g+n+ed+es+ +++ gl++ lcl|FitnessBrowser__PV4:5210398 14 ALLVLEDGTVFSGTAIGADGLAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNTGTNSEDTESEAVHACGLII 91 579*************************************************************************** PP TIGR01368 79 kelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavisteksekeelvekakespkvkevnlvke 156 ++l +sn+r+++sL+++lk++++v+i+++DTR+l++ lRekg+++++i ++++ ++ ++ak+ p +k+++l+ke lcl|FitnessBrowser__PV4:5210398 92 RDLPLLASNFRNEQSLSDYLKSNNVVGIADIDTRKLTRILREKGAQAGAILVGDMDEAKALAAAKAFPGLKGMDLAKE 169 ****************************************************************************** PP TIGR01368 157 vstkeayeleq...........kakkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgills 223 v+t+++y++++ ++ +++ k++vv++d+GvK+nilr+Lv+rg++vtvvpa+t+a+e+ ++npdgi+ls lcl|FitnessBrowser__PV4:5210398 170 VTTQKQYQWRSgswrlvgglpsDTPESELKYKVVAYDYGVKRNILRMLVDRGCDVTVVPAQTPAAEVLAMNPDGIFLS 247 **********987777666554356666679*********************************************** PP TIGR01368 224 nGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqNHgyavd 301 nGPGdP+ +++aie ++++l+++iP+fGIclGhqllala+gakt+k+kfGh+GaNhpv +l++g+v+itsqNHg+a d lcl|FitnessBrowser__PV4:5210398 248 NGPGDPEPCDYAIEAIQAFLKTDIPLFGICLGHQLLALASGAKTLKMKFGHHGANHPVSNLEKGNVMITSQNHGFAAD 325 ****************************************************************************** PP TIGR01368 302 eeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 e sl+++ ++vth++l+Dg+++g++ +++p+fs Q HPeaspGphd++ lFd+f+eli+ lcl|FitnessBrowser__PV4:5210398 326 ETSLPAN-VKVTHKSLFDGSLQGIHLTDKPAFSFQGHPEASPGPHDAAPLFDHFIELIE 383 ***8866.************************************************997 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (390 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 11.95 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory