Align 3-dehydroquinate synthase (EC 4.2.3.4) (characterized)
to candidate 5207692 Shew_0214 3-dehydroquinate synthase (RefSeq)
Query= BRENDA::P07639 (362 letters) >lcl|FitnessBrowser__PV4:5207692 Shew_0214 3-dehydroquinate synthase (RefSeq) Length = 358 Score = 421 bits (1083), Expect = e-122 Identities = 212/357 (59%), Positives = 265/357 (74%), Gaps = 1/357 (0%) Query: 1 MERIVVTLGERSYPITIASGLFNEPASFLPLKSGEQVMLVTNETLAPLYLDKVRGVLEQA 60 ME+I V LG RSYPI I L F G+++++VTN+T+APLYL KV+ +L Sbjct: 1 MEQIQVELGVRSYPIFIGQNLLENSDYFSSYLQGKKILIVTNDTIAPLYLAKVQALLASY 60 Query: 61 GVNVDSVILPDGEQYKSLAVLDTVFTALLQKPHGRDTTLVALGGGVVGDLTGFAAASYQR 120 D VILPDGEQYK+L+ +D +FT+LL + GRD+ L+ALGGGV+GD+TGFAAA YQR Sbjct: 61 QC-ADPVILPDGEQYKTLSQMDAIFTSLLAQNMGRDSVLIALGGGVIGDMTGFAAACYQR 119 Query: 121 GVRFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPASVVVDLDCLKTLPPRELAS 180 GV FIQ+PTTLLSQVDSSVGGKTAVNHP+GKNMIGAFYQP V +D CL TLP RE A+ Sbjct: 120 GVDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDTACLHTLPAREFAA 179 Query: 181 GLAEVIKYGIILDGAFFNWLEENLDALLRLDGPAMAYCIRRCCELKAEVVAADERETGLR 240 G+AEVIKYGII DG+FF+WLE+N+ AL LD A+ Y I +CC++KA+VVA DE E G+R Sbjct: 180 GMAEVIKYGIIWDGSFFSWLEQNVAALKSLDEAALTYAIAKCCQIKADVVAQDETEQGVR 239 Query: 241 ALLNLGHTFGHAIEAEMGYGNWLHGEAVAAGMVMAARTSERLGQFSSAETQRIITLLKRA 300 ALLNLGHTFGHAIEAEMGYG WLHGEAVAAG V+AA+T+ ++G + RI + + Sbjct: 240 ALLNLGHTFGHAIEAEMGYGVWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAF 299 Query: 301 GLPVNGPREMSAQAYLPHMLRDKKVLAGEMRLILPLAIGKSEVRSGVSHELVLNAIA 357 LP P M + ++ HM RDKKVL G++RL+LP AIG++EV VS L+ I+ Sbjct: 300 DLPTEAPEAMDFEQFIKHMRRDKKVLNGKLRLVLPKAIGQAEVYGEVSESLLQEVIS 356 Lambda K H 0.320 0.136 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 323 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 358 Length adjustment: 29 Effective length of query: 333 Effective length of database: 329 Effective search space: 109557 Effective search space used: 109557 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5207692 Shew_0214 (3-dehydroquinate synthase (RefSeq))
to HMM TIGR01357 (aroB: 3-dehydroquinate synthase (EC 4.2.3.4))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01357.hmm # target sequence database: /tmp/gapView.23157.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01357 [M=344] Accession: TIGR01357 Description: aroB: 3-dehydroquinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.8e-125 402.2 0.0 1.1e-124 402.1 0.0 1.0 1 lcl|FitnessBrowser__PV4:5207692 Shew_0214 3-dehydroquinate synth Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5207692 Shew_0214 3-dehydroquinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 402.1 0.0 1.1e-124 1.1e-124 1 341 [. 13 353 .. 13 356 .. 0.95 Alignments for each domain: == domain 1 score: 402.1 bits; conditional E-value: 1.1e-124 TIGR01357 1 ykvkvgegllkklveelae..kasklvvitdeeveklvaekleealkslgvevlvlvvpdgeesKsletvaklldqll 76 y++ +g++ll++ +++++ + +k++++t+++++ l+ +k++++l+s + ++ +++pdge++K+l+++ ++ + ll lcl|FitnessBrowser__PV4:5207692 13 YPIFIGQNLLENS-DYFSSylQGKKILIVTNDTIAPLYLAKVQALLAS-YQCADPVILPDGEQYKTLSQMDAIFTSLL 88 6789999999843.3444444569**********************98.67788999********************* PP TIGR01357 77 eeklerksvlvaiGGGvvgDlaGFvAatylRGirlvqvPTtllamvDssvGGKtginlplgkNliGafyqPkaVlidl 154 ++++ r+svl+a+GGGv+gD++GF+Aa y+RG++++q+PTtll++vDssvGGKt++n+p gkN+iGafyqPk+V id+ lcl|FitnessBrowser__PV4:5207692 89 AQNMGRDSVLIALGGGVIGDMTGFAAACYQRGVDFIQIPTTLLSQVDSSVGGKTAVNHPMGKNMIGAFYQPKMVAIDT 166 ****************************************************************************** PP TIGR01357 155 kvletlperelreGmaEviKhgliadaelfeelekneklllklaelealeelikrsievKaevVeeDekesglRalLN 232 ++l+tlp re+++GmaEviK+g+i+d ++f++le+n ++l++l +++al+ +i++++++Ka+vV++De+e+g+RalLN lcl|FitnessBrowser__PV4:5207692 167 ACLHTLPAREFAAGMAEVIKYGIIWDGSFFSWLEQNVAALKSL-DEAALTYAIAKCCQIKADVVAQDETEQGVRALLN 243 *************************************988865.66******************************** PP TIGR01357 233 fGHtlgHaiEallkyk.lsHGeaVaiGmvveaklseklgllkaellerlvallkklglptklkkklsveellkallkD 309 +GHt+gHaiEa+++y+ + HGeaVa G v++a+++ k+gl++++++ r++a+++++ lpt+ ++ +++e+++k++ +D lcl|FitnessBrowser__PV4:5207692 244 LGHTFGHAIEAEMGYGvWLHGEAVAAGTVLAAQTASKMGLVDQSIVCRIEAIFEAFDLPTEAPEAMDFEQFIKHMRRD 321 ****************************************************************************** PP TIGR01357 310 KKnegskiklvlleeiGkaalasevteeelle 341 KK ++k++lvl+++iG+a++ ev+e+ l+e lcl|FitnessBrowser__PV4:5207692 322 KKVLNGKLRLVLPKAIGQAEVYGEVSESLLQE 353 ********************998887665554 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (344 nodes) Target sequences: 1 (358 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 10.39 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory