Align 3-deoxy-7-phosphoheptulonate synthase, Trp-sensitive (EC 2.5.1.54) (characterized)
to candidate 5209069 Shew_1547 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq)
Query= ecocyc::AROH-MONOMER (348 letters) >FitnessBrowser__PV4:5209069 Length = 353 Score = 462 bits (1190), Expect = e-135 Identities = 223/345 (64%), Positives = 268/345 (77%) Query: 3 RTDELRTARIESLVTPAELALRYPVTPGVATHVTDSRRRIEKILNGEDKRLLVIIGPCSI 62 +TDELRT + ++PA+LA YP+T A ++ RR +E IL GEDKRLLVIIGPCSI Sbjct: 4 KTDELRTTLLCKAISPAKLASEYPLTQDAADYLVQQRREVEAILTGEDKRLLVIIGPCSI 63 Query: 63 HDLTAAMEYATRLQSLRNQYQSRLEIVMRTYFEKPRTVVGWKGLISDPDLNGSYRVNHGL 122 HD AA++YA RL L + + L I+MR YFEKPRT VGWKGLISDPDL+GS+ N GL Sbjct: 64 HDTQAAIDYAKRLAVLHKELKDSLCILMRVYFEKPRTTVGWKGLISDPDLDGSFNANKGL 123 Query: 123 ELARKLLLQVNELGVPTATEFLDMVTGQFIADLISWGAIGARTTESQIHREMASALSCPV 182 LAR LL ++ EL +P ATEFLDMV GQ+IADLI+WGA+GARTTESQIHREMASALSCPV Sbjct: 124 RLARHLLQEITELNLPIATEFLDMVNGQYIADLITWGAVGARTTESQIHREMASALSCPV 183 Query: 183 GFKNGTDGNTRIAVDAIRAARASHMFLSPDKNGQMTIYQTSGNPYGHIIMRGGKKPNYHA 242 GFKNGTDGN IA+DA+RAA+ H+F SPDK+G M +Y+TSGNPYGHII+RGGK+PNYH Sbjct: 184 GFKNGTDGNINIAIDAVRAAKEPHIFYSPDKDGAMAVYRTSGNPYGHIILRGGKQPNYHE 243 Query: 243 DDIAAACDTLHEFDLPEHLVVDFSHGNCQKQHRRQLEVCEDICQQIRNGSTAIAGIMAES 302 DI AA L + L +VVDFSHGN QKQH+RQLEV +DI Q+ +GSTAIAGIMAES Sbjct: 244 ADIQAAAQKLKDVGLSHRMVVDFSHGNSQKQHKRQLEVAKDIMTQVASGSTAIAGIMAES 303 Query: 303 FLREGTQKIVGSQPLTYGQSITDPCLGWEDTERLVEKLASAVDTR 347 F+ EG QK+V +PL YG+SITD CL W D+E+L+ LA+A R Sbjct: 304 FIEEGNQKVVAGEPLIYGKSITDACLDWADSEKLLRDLAAASKAR 348 Lambda K H 0.320 0.135 0.399 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 4 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 348 Length of database: 353 Length adjustment: 29 Effective length of query: 319 Effective length of database: 324 Effective search space: 103356 Effective search space used: 103356 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5209069 Shew_1547 (phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq))
to HMM TIGR00034 (3-deoxy-7-phosphoheptulonate synthase (EC 2.5.1.54))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00034.hmm # target sequence database: /tmp/gapView.8017.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00034 [M=342] Accession: TIGR00034 Description: aroFGH: 3-deoxy-7-phosphoheptulonate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 2.9e-165 535.0 0.0 3.3e-165 534.8 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209069 Shew_1547 phospho-2-dehydro-3-de Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209069 Shew_1547 phospho-2-dehydro-3-deoxyheptonate aldolase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 534.8 0.0 3.3e-165 3.3e-165 1 341 [. 6 348 .. 6 349 .. 0.99 Alignments for each domain: == domain 1 score: 534.8 bits; conditional E-value: 3.3e-165 TIGR00034 1 ddlrivkidelltPeelkakfpltekaaekvaksrkeiadilaGkddrllvviGPcsihdpeaaleyakrlkklaekl 78 d+lr++ + + ++P++l++++plt++aa+ + ++r+e++ il+G+d+rllv+iGPcsihd +aa++yakrl+ l ++l lcl|FitnessBrowser__PV4:5209069 6 DELRTTLLCKAISPAKLASEYPLTQDAADYLVQQRREVEAILTGEDKRLLVIIGPCSIHDTQAAIDYAKRLAVLHKEL 83 678888889999****************************************************************** PP TIGR00034 79 kddleivmrvyfekPrttvGWkGlindPdlnesfdvnkGlriarkllldlvelglplatelldtispqyladllswga 156 kd+l i+mrvyfekPrttvGWkGli+dPdl++sf+ nkGlr+ar+ll +++el+lp+ate+ld++ +qy+adl++wga lcl|FitnessBrowser__PV4:5209069 84 KDSLCILMRVYFEKPRTTVGWKGLISDPDLDGSFNANKGLRLARHLLQEITELNLPIATEFLDMVNGQYIADLITWGA 161 ****************************************************************************** PP TIGR00034 157 iGarttesqvhrelasglslpvgfkngtdGslkvaidairaaaaehlflsvtkaGqvaivetkGnedghiilrGGkkp 234 +Garttesq+hre+as+ls+pvgfkngtdG++++aida+raa+++h+f s++k+G++a+++t+Gn++ghiilrGGk+p lcl|FitnessBrowser__PV4:5209069 162 VGARTTESQIHREMASALSCPVGFKNGTDGNINIAIDAVRAAKEPHIFYSPDKDGAMAVYRTSGNPYGHIILRGGKQP 239 ****************************************************************************** PP TIGR00034 235 nydaedvaevkeelekaglkeelmidfshgnsnkdykrqlevaesvveqiaeGekaiiGvmiesnleeGnqsl..kee 310 ny+++d++++ ++l+++gl++++++dfshgns+k++krqleva++++ q+a+G++ai+G+m es++eeGnq++ +e+ lcl|FitnessBrowser__PV4:5209069 240 NYHEADIQAAAQKLKDVGLSHRMVVDFSHGNSQKQHKRQLEVAKDIMTQVASGSTAIAGIMAESFIEEGNQKVvaGEP 317 ************************************************************************98899* PP TIGR00034 311 lkyGksvtdacigwedteallrklaeavker 341 l+yGks+tdac++w d+e+llr+la+a k+r lcl|FitnessBrowser__PV4:5209069 318 LIYGKSITDACLDWADSEKLLRDLAAASKAR 348 *************************998887 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (342 nodes) Target sequences: 1 (353 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.61 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory