Align cysteine synthase (EC 2.5.1.47) (characterized)
to candidate 5209934 Shew_2382 cysteine synthase A (RefSeq)
Query= BRENDA::P0ABK5 (323 letters) >lcl|FitnessBrowser__PV4:5209934 Shew_2382 cysteine synthase A (RefSeq) Length = 322 Score = 480 bits (1235), Expect = e-140 Identities = 242/320 (75%), Positives = 273/320 (85%), Gaps = 1/320 (0%) Query: 1 MSKIFEDNSLTIGHTPLVRLNRIGNGRILAKVESRNPSFSVKCRIGANMIWDAEKRGVLK 60 MSKIFEDNS TIG+TPLVRLNR+ G +LAKVE+RNPSFSVKCRIGANMIWDAEK+G+L Sbjct: 1 MSKIFEDNSYTIGNTPLVRLNRVSKGNVLAKVEARNPSFSVKCRIGANMIWDAEKKGLLT 60 Query: 61 PGVELVEPTSGNTGIALAYVAAARGYKLTLTMPETMSIERRKLLKALGANLVLTEGAKGM 120 EL+EPTSGNTGIALAYVAAARGYKLTLTMP TMS+ERRKLLKALGANLVLTEGAKGM Sbjct: 61 KDKELIEPTSGNTGIALAYVAAARGYKLTLTMPNTMSLERRKLLKALGANLVLTEGAKGM 120 Query: 121 KGAIQKAEEIVASNPEKYLLLQQFSNPANPEIHEKTTGPEIWEDTDGQVDVFIAGVGTGG 180 KGAI KAEE+ S PEKYL+L QF NPANPEIHEKTTGPEIW DTDG+VDV +AGVGTGG Sbjct: 121 KGAIDKAEELRQSAPEKYLILGQFDNPANPEIHEKTTGPEIWNDTDGEVDVVVAGVGTGG 180 Query: 181 TLTGVSRYIKGTKGKTDLISVAVEPTDSPVIAQALAGEEIKPGPHKIQGIGAGFIPANLD 240 T+TGVSRYIK T+GK + SVAVEP DSPVI Q +AG+ ++PGPHKIQGIGAGFIP NLD Sbjct: 181 TITGVSRYIKQTQGKA-ITSVAVEPADSPVIGQTMAGQPVQPGPHKIQGIGAGFIPGNLD 239 Query: 241 LKLVDKVIGITNEEAISTARRLMEEEGILAGISSGAAVAAALKLQEDESFTNKNIVVILP 300 L ++D+V +TNEEAI A+RLM+EEGIL GISSGAAV AA ++ + F KNIVVILP Sbjct: 240 LDVIDRVEAVTNEEAIEMAQRLMKEEGILVGISSGAAVVAANRIADLPEFEGKNIVVILP 299 Query: 301 SSGERYLSTALFADLFTEKE 320 S+ ERYLS+ LF F + E Sbjct: 300 SAAERYLSSVLFQGQFGDAE 319 Lambda K H 0.313 0.133 0.368 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 415 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 323 Length of database: 322 Length adjustment: 28 Effective length of query: 295 Effective length of database: 294 Effective search space: 86730 Effective search space used: 86730 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 5209934 Shew_2382 (cysteine synthase A (RefSeq))
to HMM TIGR01139 (cysK: cysteine synthase A (EC 2.5.1.47))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01139.hmm # target sequence database: /tmp/gapView.29129.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01139 [M=298] Accession: TIGR01139 Description: cysK: cysteine synthase A Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 9.6e-146 470.6 1.1 1.1e-145 470.5 1.1 1.0 1 lcl|FitnessBrowser__PV4:5209934 Shew_2382 cysteine synthase A (R Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209934 Shew_2382 cysteine synthase A (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 470.5 1.1 1.1e-145 1.1e-145 2 298 .] 9 311 .. 8 311 .. 0.98 Alignments for each domain: == domain 1 score: 470.5 bits; conditional E-value: 1.1e-145 TIGR01139 2 seliGntPlvrLnlaeeakaevlvkleslnPsssvkdrialamiedaekegllkkgktiveatsGntGialamvaaar 79 s +iGntPlvrLn k++vl+k+e +nPs+svk+ri+++mi+daek+gll+k+k+++e+tsGntGiala+vaaar lcl|FitnessBrowser__PV4:5209934 9 SYTIGNTPLVRLN--RVSKGNVLAKVEARNPSFSVKCRIGANMIWDAEKKGLLTKDKELIEPTSGNTGIALAYVAAAR 84 679**********..44479********************************************************** PP TIGR01139 80 gykliltmpetmslerrkllkayGaelvLtdgaegmkgaiekaeelveetpnkylllkqfenpanpeihrkttapeil 157 gykl+ltmp+tmslerrkllka+Ga+lvLt+ga+gmkgai+kaeel ++ p+kyl+l qf+npanpeih+ktt+pei+ lcl|FitnessBrowser__PV4:5209934 85 GYKLTLTMPNTMSLERRKLLKALGANLVLTEGAKGMKGAIDKAEELRQSAPEKYLILGQFDNPANPEIHEKTTGPEIW 162 ****************************************************************************** PP TIGR01139 158 kdldgkldafvagvGtGGtitGvgevlkekkp.dikvvavePaespvlsgg......kpgphkiqGigagfiPkvLdk 228 +d+dg++d++vagvGtGGtitGv++++k++++ i++vavePa+spv+ ++ +pgphkiqGigagfiP +Ld lcl|FitnessBrowser__PV4:5209934 163 NDTDGEVDVVVAGVGTGGTITGVSRYIKQTQGkAITSVAVEPADSPVIGQTmagqpvQPGPHKIQGIGAGFIPGNLDL 240 *****************************99979***************99999999********************* PP TIGR01139 229 evidevikvsdeeaietarrlakeeGilvGissGaavaaalkvakkle.kdkkivvilpdtgerYlstaLf 298 +vid+v +v++eeaie+a+rl+keeGilvGissGaav+aa ++a +e ++k+ivvilp+++erYls Lf lcl|FitnessBrowser__PV4:5209934 241 DVIDRVEAVTNEEAIEMAQRLMKEEGILVGISSGAAVVAANRIADLPEfEGKNIVVILPSAAERYLSSVLF 311 ********************************************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (298 nodes) Target sequences: 1 (322 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.18 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory