Align Isocitrate lyase; ICL; Isocitrase; Isocitratase; EC 4.1.3.1 (characterized)
to candidate 5209346 Shew_1820 2-methylisocitrate lyase (RefSeq)
Query= SwissProt::D4GTL3 (345 letters) >FitnessBrowser__PV4:5209346 Length = 292 Score = 140 bits (354), Expect = 3e-38 Identities = 85/262 (32%), Positives = 136/262 (51%), Gaps = 17/262 (6%) Query: 37 GMYHALDARLAEMTGHDAAYMSGYSTVLGQFGFPDLEMVTMTEMVENAKRMVEATNLPVI 96 G +A A +A+ GH A Y+SG +G PDL M ++ +++ + +R+ A +LP++ Sbjct: 21 GTINAYTAMMAKQIGHKAIYLSGGGVANASYGLPDLGMTSLNDVIVDVQRITSACDLPLL 80 Query: 97 ADCDTGYGGIHNVRRAVREYEKAGVAAVHIEDQTTPKRCGHIAGKQIVSREKAKARFEAA 156 D DTG+GG N+ + +++ EKAG AAVH+EDQ KRCGH K+IVS E+ R +AA Sbjct: 81 VDIDTGWGGAFNIAKTIKDMEKAGAAAVHMEDQVAQKRCGHRPNKEIVSVEEMVDRIKAA 140 Query: 157 VDAKQSEDTVVIARTDAYGSSNGDWDEHVERGRIYADAGVDIVWPEMPNPSREDAVAYAE 216 VDA+ D ++ARTDA+ + +ER + Y AG D ++ E + E A+AE Sbjct: 141 VDARTDPDFFIMARTDAFAQEG--LEAAIERAKAYVAAGADGIFAEAVK-TEEHYRAFAE 197 Query: 217 EIHETHPDLKLAFNYSSSFAWSEEEDPLTFQELGDLGYKYIFITLF---GLHSGAHAVYE 273 + P L + + W+ E +LG G + L ++ A VY+ Sbjct: 198 ALDV--PILANITEFGQTELWNRE-------QLGQWGAAMVLYPLSAFRAMNKAAENVYQ 248 Query: 274 DFKKLAEQDEEGQFDLEQRYLD 295 L + D++ D Q ++ Sbjct: 249 TI--LRDGDQKAVLDTMQTRME 268 Lambda K H 0.315 0.132 0.384 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 256 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 345 Length of database: 292 Length adjustment: 27 Effective length of query: 318 Effective length of database: 265 Effective search space: 84270 Effective search space used: 84270 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory