Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate 5208066 Shew_0578 bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein (RefSeq)
Query= SwissProt::Q94AL9 (477 letters) >FitnessBrowser__PV4:5208066 Length = 405 Score = 163 bits (413), Expect = 9e-45 Identities = 109/339 (32%), Positives = 168/339 (49%), Gaps = 31/339 (9%) Query: 84 VDGKMQYLFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYLNHAIAD 143 V G+ ++D+ G ++D GIAV GHCHP +V + Q +++ H + N Sbjct: 28 VRGEGSRVWDQEGNEFVDFAGGIAVNCLGHCHPALVGALKEQGEKIWHLANVMTNEPAL- 86 Query: 144 FSEALASKLPGDL--KVVFFTNSGTEANELALMMAKLYT----GCQ--DIVAVRNGYHGN 195 ALA+KL + V+F NSG EANE AL +A+ Y G + I+A +HG Sbjct: 87 ---ALATKLVEATFAEKVYFANSGAEANEAALKLARRYALDKFGAEKDQIIAFDKAFHGR 143 Query: 196 AAATMGATGQSMWK--FNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTGHI 253 T+ GQ+ + F S+ H P+ + + E K Sbjct: 144 TFFTVSVGGQAAYSDGFGPKPQSITHL----PFNDIAALEAEVSDKT------------- 186 Query: 254 AGFICEAIQGVGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVV 313 + E +QG GGI++ P +L A K L I DEVQ+G R G + + V Sbjct: 187 CAIMLEPLQGEGGIIDADPEFLRAVRALADKHNALVIFDEVQTGVGRLGELYAYMRTEVT 246 Query: 314 PDIVTMAKGIGNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKEKL 373 PDI+T AK +G GFP+ A++TT EIA L ++ +T+GGN ++ G AVL+V+ ++ Sbjct: 247 PDILTTAKALGGGFPIAAMLTTTEIASHLKIGTHGSTYGGNPLACAIGNAVLDVVNTPEV 306 Query: 374 QENAAMVGSYLKEKLTQLKEKHEIIGDVRGRGLMLGVEL 412 + L++ L Q+ EK+ + +VRG+GL+LG L Sbjct: 307 LDGVKRREQLLRDGLNQINEKYHVFTEVRGQGLLLGAVL 345 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 459 Number of extensions: 18 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 405 Length adjustment: 32 Effective length of query: 445 Effective length of database: 373 Effective search space: 165985 Effective search space used: 165985 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory