Align Alanine--glyoxylate aminotransferase 2 homolog 2, mitochondrial; Beta-alanine-pyruvate aminotransferase 2; EC 2.6.1.44 (characterized)
to candidate 5210744 Shew_3172 4-aminobutyrate aminotransferase (RefSeq)
Query= SwissProt::Q94AL9 (477 letters) >FitnessBrowser__PV4:5210744 Length = 426 Score = 207 bits (527), Expect = 6e-58 Identities = 133/379 (35%), Positives = 196/379 (51%), Gaps = 12/379 (3%) Query: 91 LFDESGRRYLDAFAGIAVVNCGHCHPDVVEPVINQIKRLQHPTVLYLNHAIA-DFSEALA 149 L+D G+RY+D GIAV N GH HP VV V Q+ H V+ + A +E L Sbjct: 34 LWDVEGKRYIDFGTGIAVCNTGHSHPKVVAAVKAQLDNFSHTCVMVNPYESAVALAEQLN 93 Query: 150 SKLPG--DLKVVFFTNSGTEANELALMMAKLYTGCQDIVAVRNGYHGNAAATMGATGQSM 207 PG D K +F T +G EA E + +A+ +TG + ++A G+HG TM TG+ Sbjct: 94 RIAPGGSDKKAIFVT-TGAEAVENCVKIARAHTGRRGVIAFNGGFHGRTNLTMALTGKIT 152 Query: 208 ---WKFNVVQNSVHHALNPDPYRGVFGSDGEKYAKDLQDLIQYGTTG-HIAGFICEAIQG 263 +F + HA P + GV D K ++ L + +A + E +QG Sbjct: 153 PYKHQFGPFAGDIFHAPYPVAFHGVSVKDS---LKAIEHLFKVDIAPCDVAAIVVEPVQG 209 Query: 264 VGGIVELAPGYLSAAYDTVKKAGGLFIADEVQSGFARTGNFWGFEAHNVVPDIVTMAKGI 323 GG P +L A + G + + DE+Q+GF RTG + E V PD++TMAKGI Sbjct: 210 EGGFYAAPPEFLQALRALCDQHGIVLVMDEIQTGFGRTGKMFSCEHAGVEPDLMTMAKGI 269 Query: 324 GNGFPLGAVVTTPEIAGVLTRRSYFNTFGGNSVSTTAGLAVLNVIEKEKLQENAAMVGSY 383 GFPL AVV EI T+GG+ V A LAVL V+++E+L E A +G Sbjct: 270 AGGFPLAAVVGKSEIMDAPLPGGLGGTYGGSPVGCVAALAVLEVMQEEQLVERAVKIGDS 329 Query: 384 LKEKLTQLKEKH-EIIGDVRGRGLMLGVELVSDRKLKTPATAETLHIMDQMKELGVLIGK 442 + L+ LKE++ ++IG+VR +G M+ +ELV D ++ P TA T I+ G+++ Sbjct: 330 FNQALSALKEQYPQLIGEVRNQGAMIAMELVIDGDIEQPNTALTQAIIANAAAHGLVLLA 389 Query: 443 GGYFGNVFRITPPLCFTKD 461 G++GNV R P L + + Sbjct: 390 CGFYGNVIRFLPALTISDE 408 Lambda K H 0.320 0.136 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 477 Length of database: 426 Length adjustment: 33 Effective length of query: 444 Effective length of database: 393 Effective search space: 174492 Effective search space used: 174492 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory