Align IGP synthase cyclase subunit; EC 4.1.3.- (characterized)
to candidate 5209750 Shew_2203 imidazole glycerol phosphate synthase subunit HisF (RefSeq)
Query= CharProtDB::CH_024847 (258 letters) >lcl|FitnessBrowser__PV4:5209750 Shew_2203 imidazole glycerol phosphate synthase subunit HisF (RefSeq) Length = 257 Score = 388 bits (996), Expect = e-113 Identities = 192/257 (74%), Positives = 216/257 (84%) Query: 1 MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAKRYAEEGADELVFYDITASSDGRV 60 MLAKRI+PCLDVRDG+VVKGVQFRNHEI+GDIVPLA RYA E ADELVFYDITAS+ RV Sbjct: 1 MLAKRIVPCLDVRDGKVVKGVQFRNHEIVGDIVPLAARYAAESADELVFYDITASAHDRV 60 Query: 61 VDKSWVSRVAEVIDIPFCVAGGIKSLEDAAKILSFGADKISINSPALADPTLITRLADRF 120 VDKSWVSRVAE IDIPFCVAGGIKS+E A + L+FGADKISINSPAL+DP LI RL D F Sbjct: 61 VDKSWVSRVAEQIDIPFCVAGGIKSIEQAREKLAFGADKISINSPALSDPGLIDRLQDEF 120 Query: 121 GVQCIVVGIDTWYDAETGKYHVNQYTGDESRTRVTQWETLDWVQEVQKRGAGEIVLNMMN 180 G QCIV+GID++YDA+T Y V Q+TGDE+ T+ TQW T DWV+EVQ+RG GEIVLN+MN Sbjct: 121 GRQCIVIGIDSYYDADTDSYKVKQFTGDEAATKDTQWYTQDWVEEVQRRGCGEIVLNVMN 180 Query: 181 QDGVRNGYDLEQLKKVREVCHVPLIASGGAGTMEHFLEAFRDADVDGALAASVFHKQIIN 240 QDGVR GYD++QL VR +C VPLIASGGAGTMEHFLE F A VD ALAASVFHK II Sbjct: 181 QDGVRQGYDIKQLAMVRAICDVPLIASGGAGTMEHFLEVFTQAGVDAALAASVFHKGIIE 240 Query: 241 IGELKAYLATQGVEIRI 257 I LK YL GV++R+ Sbjct: 241 IEALKRYLLDNGVQMRL 257 Lambda K H 0.321 0.138 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 314 Number of extensions: 7 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 258 Length of database: 257 Length adjustment: 24 Effective length of query: 234 Effective length of database: 233 Effective search space: 54522 Effective search space used: 54522 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 5209750 Shew_2203 (imidazole glycerol phosphate synthase subunit HisF (RefSeq))
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00735.hmm # target sequence database: /tmp/gapView.17977.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00735 [M=254] Accession: TIGR00735 Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.3e-107 344.8 1.8 1.5e-107 344.6 1.8 1.0 1 lcl|FitnessBrowser__PV4:5209750 Shew_2203 imidazole glycerol pho Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209750 Shew_2203 imidazole glycerol phosphate synthase subunit HisF (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 344.6 1.8 1.5e-107 1.5e-107 1 254 [] 1 256 [. 1 256 [. 0.99 Alignments for each domain: == domain 1 score: 344.6 bits; conditional E-value: 1.5e-107 TIGR00735 1 mlakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevvervaekvfiPlt 78 mlakri+pCLdv+dg+vvkGvqf+n++ +Gd+v+la++y++e adelvf+ditas+++r +++++v+rvae+++iP++ lcl|FitnessBrowser__PV4:5209750 1 MLAKRIVPCLDVRDGKVVKGVQFRNHEIVGDIVPLAARYAAESADELVFYDITASAHDRVVDKSWVSRVAEQIDIPFC 78 8***************************************************************************** PP TIGR00735 79 vgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaeneeakyevtikgGres.... 152 v+GGiksie++++ l++Gadk+sin++a+ +p li +l d fG+q+iv++id+ ++a+++ +y+v++ +G+e lcl|FitnessBrowser__PV4:5209750 79 VAGGIKSIEQAREKLAFGADKISINSPALSDPGLIDRLQDEFGRQCIVIGIDSYYDADTD--SYKVKQFTGDEAatkd 154 *******************************************************99885..9********9987777 PP TIGR00735 153 tdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPviasgGaGkaehleeaflkgkadaaLaas 230 t++ + +w++ev+++G Gei+l++m++dG+++Gyd+++l v+ +++P+iasgGaG++eh+ e+f+++ +daaLaas lcl|FitnessBrowser__PV4:5209750 155 TQWYTQDWVEEVQRRGCGEIVLNVMNQDGVRQGYDIKQLAMVRAICDVPLIASGGAGTMEHFLEVFTQAGVDAALAAS 232 9999************************************************************************** PP TIGR00735 231 vfhkreltieevkeylaergvkvr 254 vfhk++++ie +k+yl+++gv++r lcl|FitnessBrowser__PV4:5209750 233 VFHKGIIEIEALKRYLLDNGVQMR 256 **********************98 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (254 nodes) Target sequences: 1 (257 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.01 # Mc/sec: 6.51 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory