Align ribose-phosphate diphosphokinase (EC 2.7.6.1) (characterized)
to candidate 5210475 Shew_2916 ribose-phosphate pyrophosphokinase (RefSeq)
Query= BRENDA::P0A719 (315 letters) >FitnessBrowser__PV4:5210475 Length = 324 Score = 525 bits (1352), Expect = e-154 Identities = 261/315 (82%), Positives = 291/315 (92%) Query: 1 MPDMKLFAGNATPELAQRIANRLYTSLGDAAVGRFSDGEVSVQINENVRGGDIFIIQSTC 60 +PD+KLFAGNATP LA++IA+RL+ LGDA VG FSDGE+SVQINENVRG D+FIIQSTC Sbjct: 10 VPDIKLFAGNATPSLAKKIADRLFCKLGDAEVGVFSDGEISVQINENVRGADVFIIQSTC 69 Query: 61 APTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV 120 APTNDNLMEL+VMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV Sbjct: 70 APTNDNLMELIVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKVVADFLSSV 129 Query: 121 GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQLNLDNPIVVSPDIGGVVRARAI 180 GVDRVLT DLHAEQIQGFFDVPVDNVFGSP+LLEDML LDNP+VVSPDIGGVVRARA+ Sbjct: 130 GVDRVLTCDLHAEQIQGFFDVPVDNVFGSPVLLEDMLAKQLDNPVVVSPDIGGVVRARAV 189 Query: 181 AKLLNDTDMAIIDKRRPRANVSQVMHIIGDVAGRDCVLVDDMIDTGGTLCKAAEALKERG 240 AKLL+D+D+AIIDKRRP+ANV+QVMHIIGDV GRDC++VDDMIDTGGTLCKAAEALKE G Sbjct: 190 AKLLDDSDLAIIDKRRPQANVAQVMHIIGDVQGRDCIIVDDMIDTGGTLCKAAEALKEHG 249 Query: 241 AKRVFAYATHPIFSGNAANNLRNSVIDEVVVCDTIPLSDEIKSLPNVRTLTLSGMLAEAI 300 A RVFAYATHP+FSGNA N+ SVIDEV+V DTIPLS+E+ +L V LT+S ++AEAI Sbjct: 250 ANRVFAYATHPVFSGNAPKNIAESVIDEVIVTDTIPLSEEMAALDKVTQLTMSSVMAEAI 309 Query: 301 RRISNEESISAMFEH 315 RR+SNEESISAMF+H Sbjct: 310 RRVSNEESISAMFKH 324 Lambda K H 0.321 0.137 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 430 Number of extensions: 7 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 315 Length of database: 324 Length adjustment: 28 Effective length of query: 287 Effective length of database: 296 Effective search space: 84952 Effective search space used: 84952 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
Align candidate 5210475 Shew_2916 (ribose-phosphate pyrophosphokinase (RefSeq))
to HMM TIGR01251 (prs: ribose-phosphate diphosphokinase (EC 2.7.6.1))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01251.hmm # target sequence database: /tmp/gapView.1679.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01251 [M=309] Accession: TIGR01251 Description: ribP_PPkin: ribose-phosphate diphosphokinase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.6e-129 417.2 2.8 1.8e-129 417.0 2.8 1.0 1 lcl|FitnessBrowser__PV4:5210475 Shew_2916 ribose-phosphate pyrop Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210475 Shew_2916 ribose-phosphate pyrophosphokinase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 417.0 2.8 1.8e-129 1.8e-129 2 309 .] 14 323 .. 13 323 .. 0.98 Alignments for each domain: == domain 1 score: 417.0 bits; conditional E-value: 1.8e-129 TIGR01251 2 kilsgssskelaekvaknlglelgdvevkkFadgElyvrieesvrgkdvfiivqstsapvndalmellllidalkras 79 k+++g+++++la+k+a++l +lgd+ev F+dgE++v+i+e+vrg dvfii qst+ap+nd+lmel++++dal+ras lcl|FitnessBrowser__PV4:5210475 14 KLFAGNATPSLAKKIADRLFCKLGDAEVGVFSDGEISVQINENVRGADVFII-QSTCAPTNDNLMELIVMVDALRRAS 90 89**************************************************.************************* PP TIGR01251 80 aksvtaviPyygYaRqdkkak.srepisaklvaklleeaGadrvltvdlHseqiqgfFdvpvenlsaspklieelkkk 156 a+++taviPy+gYaRqd++++ r pi+ak+va++l+++G+drvlt dlH+eqiqgfFdvpv+n+ +sp+l+e++ +k lcl|FitnessBrowser__PV4:5210475 91 AGRITAVIPYFGYARQDRRVRsARVPITAKVVADFLSSVGVDRVLTCDLHAEQIQGFFDVPVDNVFGSPVLLEDMLAK 168 *******************9857******************************************************* PP TIGR01251 157 elknlvvvsPDkGaverakkvakklg.lelaiieKeRdskenevevtnllgdvegkdvvivDDiisTggTlvkaaelL 233 +l+n+vvvsPD G+v ra++vak l+ ++laii+K+R+ ++n+++v++++gdv+g+d++ivDD+i+TggTl+kaae+L lcl|FitnessBrowser__PV4:5210475 169 QLDNPVVVSPDIGGVVRARAVAKLLDdSDLAIIDKRRP-QANVAQVMHIIGDVQGRDCIIVDDMIDTGGTLCKAAEAL 245 *************************99***********.888************************************ PP TIGR01251 234 kekGAkkvivaathgvfsgdAlerlaeagveevivtntilv.ee.kklpkvseisvapliaeaiarihenesvsslfd 309 ke+GA++v+++ath+vfsg+A +++ae++++evivt+ti+ ee +l+kv++++++ ++aeai+r++++es+s++f+ lcl|FitnessBrowser__PV4:5210475 246 KEHGANRVFAYATHPVFSGNAPKNIAESVIDEVIVTDTIPLsEEmAALDKVTQLTMSSVMAEAIRRVSNEESISAMFK 323 *****************************************877899*****************************95 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (309 nodes) Target sequences: 1 (324 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.00u 0.01s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.87 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory