Align 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7) (characterized)
to candidate 5209377 Shew_1848 dihydrodipicolinate synthase (RefSeq)
Query= BRENDA::A5F699 (292 letters) >FitnessBrowser__PV4:5209377 Length = 294 Score = 338 bits (867), Expect = 9e-98 Identities = 169/291 (58%), Positives = 213/291 (73%) Query: 1 MFSGSIVALITPFTPDGEVDYISLKKLVDFHVDAGTDAIVSVGTTGESATLTVEEHVKVV 60 M +GSIVALITP DG VDY SL+KLV++H++ GTDAIV+VGTTGESATL + EH++VV Sbjct: 1 MINGSIVALITPMNRDGSVDYASLEKLVEYHIEQGTDAIVAVGTTGESATLPLSEHIEVV 60 Query: 61 AKTVEFAEGRLPIIAGTGANATHEAVTFSRLLNNTGIAGYLSVTPYYNKPTQEGLFLHYN 120 A TV+FA GR+P+I G GANAT EA+ ++ N G+A L VTPYYNKPT +GL HY+ Sbjct: 61 AHTVKFAAGRVPVIGGNGANATAEAIELTKAQANLGVAAMLGVTPYYNKPTPKGLVAHYS 120 Query: 121 AIAQETDIPVILYNVPGRTAVDMRPETVARLSEIKNIVALKDATGDLSRVAKHREMCKEG 180 A+A TDIP ILYNVPGRT+VDM PETVA+L ++ NI+ +K+ATGDLSRVA+ RE+C + Sbjct: 121 AVAAATDIPQILYNVPGRTSVDMLPETVAQLVDVPNIIGVKEATGDLSRVARLRELCGDD 180 Query: 181 FVLLSGDDATGLEFVKLGGQGVISVTNNIAAADMAKMMHLALDGKFDEAASINQRLMTLH 240 F+L SGDDAT EF+ LGG GVISV NNI M AL G + A + L Sbjct: 181 FMLYSGDDATAREFLTLGGNGVISVANNIVPKQFKLMCDAALKGDLEGALKAEAPMKDLF 240 Query: 241 KNLFIESSPIPVKWAAHKMGLIANGDLRLPLTQLSEPARPIVAQALSEACI 291 LF E++PIPVKWAAH+MGLI+ G +RLPLT+LSE ++ +A+ A I Sbjct: 241 SALFCEANPIPVKWAAHRMGLISQGHIRLPLTELSEQYHGLLLEAMKNAGI 291 Lambda K H 0.318 0.134 0.379 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 286 Number of extensions: 8 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 294 Length adjustment: 26 Effective length of query: 266 Effective length of database: 268 Effective search space: 71288 Effective search space used: 71288 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
Align candidate 5209377 Shew_1848 (dihydrodipicolinate synthase (RefSeq))
to HMM TIGR00674 (dapA: 4-hydroxy-tetrahydrodipicolinate synthase (EC 4.3.3.7))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00674.hmm # target sequence database: /tmp/gapView.7292.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00674 [M=286] Accession: TIGR00674 Description: dapA: 4-hydroxy-tetrahydrodipicolinate synthase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 8.9e-114 365.1 0.0 9.9e-114 365.0 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209377 Shew_1848 dihydrodipicolinate sy Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209377 Shew_1848 dihydrodipicolinate synthase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 365.0 0.0 9.9e-114 9.9e-114 1 284 [. 4 287 .. 4 289 .. 0.98 Alignments for each domain: == domain 1 score: 365.0 bits; conditional E-value: 9.9e-114 TIGR00674 1 gvltAliTPfkedgsvdfaalekliesqiekgvdaivvvGtTGEsatLsleEkkkvievavelvknrvpviaGtgsna 78 g+++AliTP+++dgsvd+a+lekl+e++ie+g+daiv+vGtTGEsatL l E+++v+ +v+++++rvpvi G g+na lcl|FitnessBrowser__PV4:5209377 4 GSIVALITPMNRDGSVDYASLEKLVEYHIEQGTDAIVAVGTTGESATLPLSEHIEVVAHTVKFAAGRVPVIGGNGANA 81 589*************************************************************************** PP TIGR00674 79 teeaieltkeaeklgvdgvlvvtPyYnkPtqeGlykhfkaiaeevelPiilYnvPsRtgvslepetvkrLaeeveiva 156 t+eaieltk ++lgv+++l vtPyYnkPt +Gl++h+ a+a+++++P+ilYnvP+Rt+v++ petv++L++ ++i++ lcl|FitnessBrowser__PV4:5209377 82 TAEAIELTKAQANLGVAAMLGVTPYYNKPTPKGLVAHYSAVAAATDIPQILYNVPGRTSVDMLPETVAQLVDVPNIIG 159 ****************************************************************************** PP TIGR00674 157 iKeasgdlervseikaeakedfkvlsGdDaltleilalGakGviSVasnvapkelkemvkaalegdteeareihqkll 234 +Kea+gdl+rv ++++ ++df ++sGdDa++ e+l+lG++GviSVa+n++pk++k m+ aal+gd e a++ ++ ++ lcl|FitnessBrowser__PV4:5209377 160 VKEATGDLSRVARLRELCGDDFMLYSGDDATAREFLTLGGNGVISVANNIVPKQFKLMCDAALKGDLEGALKAEAPMK 237 ****************************************************************************** PP TIGR00674 235 klfkalfietNPipvKtalallgliekdelRlPLtelseekkeklkevlk 284 +lf+alf+e+NPipvK+a++ +gli + ++RlPLtelse+ + l e++k lcl|FitnessBrowser__PV4:5209377 238 DLFSALFCEANPIPVKWAAHRMGLISQGHIRLPLTELSEQYHGLLLEAMK 287 ***************************************98877766665 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (286 nodes) Target sequences: 1 (294 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.00 # Mc/sec: 11.27 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory