Align dihydrodipicolinate reductase; EC 1.3.1.26 (characterized)
to candidate 5210399 Shew_2840 dihydrodipicolinate reductase (RefSeq)
Query= CharProtDB::CH_002128 (273 letters) >FitnessBrowser__PV4:5210399 Length = 271 Score = 332 bits (852), Expect = 4e-96 Identities = 169/267 (63%), Positives = 201/267 (75%) Query: 6 IRVAIAGAGGRMGRQLIQAALALEGVQLGAALEREGSSLLGSDAGELAGAGKTGVTVQSS 65 +RVAI G GRMGR LI++A + LGAA+ER GS+L+G DAGELAG G V + S Sbjct: 5 VRVAITGGSGRMGRTLIESAKLSSNIYLGAAVERAGSTLIGVDAGELAGVGAMNVAITDS 64 Query: 66 LDAVKDDFDVFIDFTRPEGTLNHLAFCRQHGKGMVIGTTGFDEAGKQAIRDAAADIAIVF 125 LD DDFD+ IDFT PE ++ H +C ++GK +VIGTTGF+ A K+ I A + IV Sbjct: 65 LDNAVDDFDILIDFTSPEASVVHTDWCSRNGKAIVIGTTGFNHAQKEQIAAYAENTPIVM 124 Query: 126 AANFSVGVNVMLKLLEKAAKVMGDYTDIEIIEAHHRHKVDAPSGTALAMGEAIAHALDKD 185 A N SVGVN+M +LLE AA+VMGDYTDIEIIE HHRHK DAPSGTAL MGE IA L +D Sbjct: 125 APNMSVGVNLMWRLLELAAEVMGDYTDIEIIEGHHRHKKDAPSGTALKMGEVIAEVLGRD 184 Query: 186 LKDCAVYSREGHTGERVPGTIGFATVRAGDIVGEHTAMFADIGERLEITHKASSRMTFAN 245 L+ CAVY REG T ER TIGF+T+RAGD+VGEHTAMFADIGERLEITHKASSRMTFAN Sbjct: 185 LEKCAVYGREGITEERSRETIGFSTIRAGDLVGEHTAMFADIGERLEITHKASSRMTFAN 244 Query: 246 GAVRSALWLSGKESGLFDMRDVLDLNN 272 GA+R+A WL + GL+DM+ VL L + Sbjct: 245 GAMRAAFWLGDQGPGLYDMQQVLGLKD 271 Lambda K H 0.319 0.135 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 293 Number of extensions: 10 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 273 Length of database: 271 Length adjustment: 25 Effective length of query: 248 Effective length of database: 246 Effective search space: 61008 Effective search space used: 61008 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
Align candidate 5210399 Shew_2840 (dihydrodipicolinate reductase (RefSeq))
to HMM TIGR00036 (dapB: 4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00036.hmm # target sequence database: /tmp/gapView.17536.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00036 [M=270] Accession: TIGR00036 Description: dapB: 4-hydroxy-tetrahydrodipicolinate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.1e-105 336.6 1.3 6.9e-105 336.4 1.3 1.0 1 lcl|FitnessBrowser__PV4:5210399 Shew_2840 dihydrodipicolinate re Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5210399 Shew_2840 dihydrodipicolinate reductase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 336.4 1.3 6.9e-105 6.9e-105 2 270 .] 5 268 .. 4 268 .. 0.99 Alignments for each domain: == domain 1 score: 336.4 bits; conditional E-value: 6.9e-105 TIGR00036 2 ikvavaGaaGrmGrevikavkeaedlelvaalerkgsskqgkDiGelagigkvgvpveddleavkvlaekkadvliDf 79 ++va++G +GrmGr +i+++k + ++ l+aa+er gs + g D+Gelag+g ++v+++d+l+ + +++d+liDf lcl|FitnessBrowser__PV4:5210399 5 VRVAITGGSGRMGRTLIESAKLSSNIYLGAAVERAGSTLIGVDAGELAGVGAMNVAITDSLDNA----VDDFDILIDF 78 79************************************************************87....9********* PP TIGR00036 80 ttpeavlenvkialekgvrlVvGTTGfseedlkelkdlaekkgvalviapNfaiGvnlllkllekaakvledv.DiEi 156 t pea + ++ + ++g+ +V+GTTGf+ ++++++++ ae+ +++v+apN+++Gvnl+++lle aa+v++d+ DiEi lcl|FitnessBrowser__PV4:5210399 79 TSPEASVVHTDWCSRNGKAIVIGTTGFNHAQKEQIAAYAEN--TPIVMAPNMSVGVNLMWRLLELAAEVMGDYtDIEI 154 ****************************************9..*********************************** PP TIGR00036 157 iElHHrhKkDaPSGTAlklaeiiakargkdlkeaaveeregltGerkkeeiGiaavRggdvvgehtvlFasdGerlei 234 iE HHrhKkDaPSGTAlk++e+ia++ g+dl+++av++reg+t er++e+iG++++R+gd+vgeht +Fa++Gerlei lcl|FitnessBrowser__PV4:5210399 155 IEGHHRHKKDAPSGTALKMGEVIAEVLGRDLEKCAVYGREGITEERSRETIGFSTIRAGDLVGEHTAMFADIGERLEI 232 ****************************************************************************** PP TIGR00036 235 tHkassRaafakGvvrairwledkeekvydledvld 270 tHkassR++fa+G++ra+ wl d+ ++yd+++vl+ lcl|FitnessBrowser__PV4:5210399 233 THKASSRMTFANGAMRAAFWLGDQGPGLYDMQQVLG 268 **********************************96 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (270 nodes) Target sequences: 1 (271 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 10.80 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory