Align Diaminopimelate decarboxylase; DAP decarboxylase; DAPDC; EC 4.1.1.20 (characterized)
to candidate 5207805 Shew_0322 diaminopimelate decarboxylase (RefSeq)
Query= SwissProt::B4XMC6 (405 letters) >lcl|FitnessBrowser__PV4:5207805 Shew_0322 diaminopimelate decarboxylase (RefSeq) Length = 414 Score = 320 bits (819), Expect = 6e-92 Identities = 172/393 (43%), Positives = 245/393 (62%), Gaps = 2/393 (0%) Query: 7 LFQTHKTPFYLYDFDKIKQAFLNYKEAFKGRKSLICYALKANSNLSILSLLAHLESGADC 66 L +T+ TP Y+Y +++ + + A +ICYA+KANSNL++L++LA L SG D Sbjct: 21 LAETYGTPLYVYSRATLERHWHAFDNAVADHPHMICYAVKANSNLAVLNVLARLGSGFDI 80 Query: 67 VSIGEIQRALKAGIKPYRIVFSGVGKSAFEIEQALKLNILFLNVESFMELKTIETIAQSL 126 VS GE+ R L+AG + ++VFSGVGK+ E+E AL+ I NVES EL+ + +A L Sbjct: 81 VSGGELARVLEAGGEASKVVFSGVGKTVAEMEMALEAGIYCFNVESAAELEQLNLVALRL 140 Query: 127 GIKARISIRINPNIDAKTHPYISTGLKENKFGVGEKEALEMFLWAKKSAFLEPVSVHFHI 186 G A +S+R+NP++DA THPYISTGLKENKFG+ +EA +FL A + L HI Sbjct: 141 GKVAPVSLRVNPDVDAGTHPYISTGLKENKFGIAMEEAEAIFLRANELPGLAVKGADCHI 200 Query: 187 GSQLLDLEPIIEASQKVAKIAKSLIALGIDLRFFDVGGGIGVSYENEETIKLYDYAQGIL 246 GSQL +L+P ++A ++ + L G+ + DVGGG+GV+Y+ E+ + YA +L Sbjct: 201 GSQLTELQPFLDAMDRMLALIDRLAEQGVKIAHLDVGGGLGVTYDGEQPPEPSAYASALL 260 Query: 247 NALQGLDLTIICEPGRSIVAESGELITQVLYEKKAQNKRFVIVDAGMNDFLRPSLYHAKH 306 L G DL +I EPGR+I A +G +TQVLY K+ K F +VD MND +RPSLY A Sbjct: 261 GKLAGRDLKLIFEPGRAIAANAGIFVTQVLYLKENAEKNFALVDGAMNDLIRPSLYSAWQ 320 Query: 307 AIRVITPSKGREISPCDVVGPVCESSDTFLKDAHLPELEPGDKIAIEKVGAYGSSMASQY 366 I + P G E DVVGPVCE+ D KD L + D +A+ GAYG +MAS Y Sbjct: 321 KIIPVVPRPG-ETRQYDVVGPVCETGDFLGKDRAL-NIRANDLLAVRSSGAYGFTMASNY 378 Query: 367 NSRPKLLELALEDHKIRVIRKREALEDLWRLEE 399 NSRP+ E+ ++ + ++R+RE + LW+ E+ Sbjct: 379 NSRPRAAEVMVDGERHYLVREREKVAQLWQGEQ 411 Lambda K H 0.319 0.138 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 411 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 405 Length of database: 414 Length adjustment: 31 Effective length of query: 374 Effective length of database: 383 Effective search space: 143242 Effective search space used: 143242 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate 5207805 Shew_0322 (diaminopimelate decarboxylase (RefSeq))
to HMM TIGR01048 (lysA: diaminopimelate decarboxylase (EC 4.1.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01048.hmm # target sequence database: /tmp/gapView.29985.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01048 [M=417] Accession: TIGR01048 Description: lysA: diaminopimelate decarboxylase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3.9e-161 522.1 0.0 4.6e-161 521.9 0.0 1.0 1 lcl|FitnessBrowser__PV4:5207805 Shew_0322 diaminopimelate decarb Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5207805 Shew_0322 diaminopimelate decarboxylase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 521.9 0.0 4.6e-161 4.6e-161 5 416 .. 7 410 .. 4 411 .. 0.98 Alignments for each domain: == domain 1 score: 521.9 bits; conditional E-value: 4.6e-161 TIGR01048 5 kdgeleiegvdlkelaeefgtPlYvydeetlrerlealkeafkaeeslvlYAvKAnsnlavlrllaeeGlgldvvsgG 82 ++ el++e++ +++lae++gtPlYvy+++tl+++++a+++a++++ ++++YAvKAnsnlavl++la++G+g+d+vsgG lcl|FitnessBrowser__PV4:5207805 7 QQDELYAEQCTVASLAETYGTPLYVYSRATLERHWHAFDNAVADHPHMICYAVKANSNLAVLNVLARLGSGFDIVSGG 84 566899************************************************************************ PP TIGR01048 83 EleralaAgvkaekivfsgngkseeeleaaleleiklinvdsveelelleeiakelgkkarvllRvnpdvdaktheyi 160 El+r+l+Ag +a+k+vfsg+gk+ +e+e+ale++i ++nv+s +ele+l+ +a +lgk a+v+lRvnpdvda th+yi lcl|FitnessBrowser__PV4:5207805 85 ELARVLEAGGEASKVVFSGVGKTVAEMEMALEAGIYCFNVESAAELEQLNLVALRLGKVAPVSLRVNPDVDAGTHPYI 162 ****************************************************************************** PP TIGR01048 161 sTGlkesKFGieveeaeeayelalkleslelvGihvHIGSqildlepfveaaekvvklleelkeegieleeldlGGGl 238 sTGlke+KFGi++eeae+++ +a +l+ l + G ++HIGSq+++l+pf +a+++++ l+++l+e+g+++++ld+GGGl lcl|FitnessBrowser__PV4:5207805 163 STGLKENKFGIAMEEAEAIFLRANELPGLAVKGADCHIGSQLTELQPFLDAMDRMLALIDRLAEQGVKIAHLDVGGGL 240 ****************************************************************************** PP TIGR01048 239 gisyeeeeeapdleeyaeklleklekeaelglklklilEpGRslvanagvlltrVesvKevesrkfvlvDagmndliR 316 g++y+ e+ +p+++ ya++ll kl++ ++lkli+EpGR+++anag+++t+V ++Ke+ +++f+lvD++mndliR lcl|FitnessBrowser__PV4:5207805 241 GVTYDGEQ-PPEPSAYASALLGKLAG-----RDLKLIFEPGRAIAANAGIFVTQVLYLKENAEKNFALVDGAMNDLIR 312 *****999.**************999.....6********************************************** PP TIGR01048 317 palYeayheiaalkrleeeetetvdvvGplCEsgDvlakdrelpeveeGdllavasaGAYgasmssnYnsrprpaevl 394 p+lY+a+++i+++ + et ++dvvGp+CE+gD+l+kdr+l+ ++ dllav+s+GAYg++m+snYnsrpr+aev+ lcl|FitnessBrowser__PV4:5207805 313 PSLYSAWQKIIPV-VPRPGETRQYDVVGPVCETGDFLGKDRALNI-RANDLLAVRSSGAYGFTMASNYNSRPRAAEVM 388 *************.668888***********************85.559***************************** PP TIGR01048 395 veegkarlirrretledllale 416 v++++ +l+r+re++++l++ e lcl|FitnessBrowser__PV4:5207805 389 VDGERHYLVREREKVAQLWQGE 410 *******************976 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (417 nodes) Target sequences: 1 (414 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.02 # Mc/sec: 7.58 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory