GapMind for Amino acid biosynthesis

 

Aligments for a candidate for metA in Shewanella loihica PV-4

Align Homoserine O-succinyltransferase; HST; Homoserine transsuccinylase; HTS; EC 2.3.1.46 (characterized)
to candidate 5210107 Shew_2551 homoserine O-succinyltransferase (RefSeq)

Query= SwissProt::A6WLE9
         (313 letters)



>lcl|FitnessBrowser__PV4:5210107 Shew_2551 homoserine
           O-succinyltransferase (RefSeq)
          Length = 321

 Score =  565 bits (1457), Expect = e-166
 Identities = 266/311 (85%), Positives = 289/311 (92%)

Query: 1   MPVRIPDHLPAAEVLESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN 60
           MPV+IPD+LPAAE+LESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN
Sbjct: 1   MPVKIPDNLPAAEILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGN 60

Query: 61  TPLQVDVDLLRIHDKESKHTSIDHMNTFYRDFEAVRHKNYDGLIITGAPLGQIDFEDVVY 120
           TPLQVDVDLLRIHDK SKHTSIDHMN FYRDFEAVRHKNYDGLIITGAPLGQI+FE+V Y
Sbjct: 61  TPLQVDVDLLRIHDKVSKHTSIDHMNNFYRDFEAVRHKNYDGLIITGAPLGQIEFEEVTY 120

Query: 121 WDHIREIIDWSQEHVTSVLFLCWAAHAGLYHLYGLNRKILQQKRSGVFVHRRTSQHFPLL 180
           WDHIREIIDWSQ HVTSVLFLCWAAHA LYHLYGL RK+L  KRSGVF H+RT +HFPLL
Sbjct: 121 WDHIREIIDWSQHHVTSVLFLCWAAHAALYHLYGLQRKLLSAKRSGVFNHQRTHKHFPLL 180

Query: 181 RGFDDEFFAPHSRFAEMDVEEIRQHPQLQLLAESDEAGAYLVLSRNNRNLFVMGHPEYQK 240
           RGFDDEFFAPHSRFAEM+V +++ H +LQ+LAESDEAGAYLVLSRNNRNLFVMGHPEYQK
Sbjct: 181 RGFDDEFFAPHSRFAEMEVADLKAHKELQVLAESDEAGAYLVLSRNNRNLFVMGHPEYQK 240

Query: 241 STLNEEYQRDLSQGLDPNVPQNYYRNDDPKADAIARWHSHGSLLVSNWLNYYVYQLTPYD 300
           STL +EYQRDL++GL+P VP+NY+R DDP    +ARWH HGSLLVSNWLNYYVYQLTPYD
Sbjct: 241 STLKDEYQRDLAEGLNPRVPKNYFRGDDPSQAPVARWHGHGSLLVSNWLNYYVYQLTPYD 300

Query: 301 LSDMTAMTPWE 311
           L DM+A+TPWE
Sbjct: 301 LHDMSAITPWE 311


Lambda     K      H
   0.321    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 463
Number of extensions: 11
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 313
Length of database: 321
Length adjustment: 27
Effective length of query: 286
Effective length of database: 294
Effective search space:    84084
Effective search space used:    84084
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate 5210107 Shew_2551 (homoserine O-succinyltransferase (RefSeq))
to HMM TIGR01001 (metA: homoserine O-succinyltransferase (EC 2.3.1.46))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01001.hmm
# target sequence database:        /tmp/gapView.4775.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01001  [M=301]
Accession:   TIGR01001
Description: metA: homoserine O-succinyltransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
   1.6e-143  463.8   0.4   1.8e-143  463.6   0.4    1.0  1  lcl|FitnessBrowser__PV4:5210107  Shew_2551 homoserine O-succinylt


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__PV4:5210107  Shew_2551 homoserine O-succinyltransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  463.6   0.4  1.8e-143  1.8e-143       1     300 [.       1     301 [.       1     302 [. 0.99

  Alignments for each domain:
  == domain 1  score: 463.6 bits;  conditional E-value: 1.8e-143
                        TIGR01001   1 mpirvpdelpavellkeenifvmtekrashqdirplevlilnlmpkkietenqllrllsnsplqvditllridsrksk 78 
                                      mp+++pd+lpa e+l+ enifvm+e ra +qdirp++vlilnlmp+kiete+qllrll+n+plqvd++llri++++sk
  lcl|FitnessBrowser__PV4:5210107   1 MPVKIPDNLPAAEILESENIFVMSETRAANQDIRPMKVLILNLMPNKIETETQLLRLLGNTPLQVDVDLLRIHDKVSK 78 
                                      9***************************************************************************** PP

                        TIGR01001  79 ntpiehlekfykeleevkdrkfdGlivtGapvellefedvayweelkeilewskenvtstlyicwaaqaalkllygip 156
                                      +t i+h+++fy+++e+v+++++dGli+tGap++++efe+v yw++++ei++ws+++vts l++cwaa+aal+ lyg++
  lcl|FitnessBrowser__PV4:5210107  79 HTSIDHMNNFYRDFEAVRHKNYDGLIITGAPLGQIEFEEVTYWDHIREIIDWSQHHVTSVLFLCWAAHAALYHLYGLQ 156
                                      ****************************************************************************** PP

                        TIGR01001 157 krtleeklsGvykhdiv.kedlllrgfddkflaphsryadldeeliaeltdleilaesdeagvylaaskdernifvtG 233
                                      ++ l+ k sGv++h+ + k+ +llrgfdd+f+aphsr+a+++ ++++++++l++laesdeag+yl++s+++rn+fv+G
  lcl|FitnessBrowser__PV4:5210107 157 RKLLSAKRSGVFNHQRThKHFPLLRGFDDEFFAPHSRFAEMEVADLKAHKELQVLAESDEAGAYLVLSRNNRNLFVMG 234
                                      **************98868999******************************************************** PP

                        TIGR01001 234 hpeydketlrqeyvrdvgeglkvdipknyypkddpektpiaswrshanllfanwlnyavyqktpydl 300
                                      hpey+k tl++ey rd+ egl++ +pkny+  ddp++ p+a w+ h+ ll +nwlny+vyq tpydl
  lcl|FitnessBrowser__PV4:5210107 235 HPEYQKSTLKDEYQRDLAEGLNPRVPKNYFRGDDPSQAPVARWHGHGSLLVSNWLNYYVYQLTPYDL 301
                                      ******************************************************************9 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (301 nodes)
Target sequences:                          1  (321 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.59
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory