Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate 5209480 Shew_1950 phosphoserine aminotransferase (RefSeq)
Query= BRENDA::P23721 (362 letters) >FitnessBrowser__PV4:5209480 Length = 364 Score = 406 bits (1043), Expect = e-118 Identities = 208/364 (57%), Positives = 262/364 (71%), Gaps = 5/364 (1%) Query: 1 MAQIFNFSSGPAMLPAEVLKQAQQELRDWNGLGTSVMEVSHRGKEFIQVAEEAEKDFRDL 60 M+ +NF +GPAMLP V+++AQ+EL DWNG G SVME+SHR KEFI + E+AE D RDL Sbjct: 1 MSATYNFCAGPAMLPQPVMQKAQEELLDWNGQGVSVMEISHRSKEFIALTEQAEADIRDL 60 Query: 61 LNVPSNYKVLFCHGGGRGQFAAVPLNILGDKTTADYVDAGYWAASAIKEAKKYCTPNVFD 120 +N+PSNY VLF HGGGRGQFAAV N+LG++ A Y+ G W+++A++EAKK D Sbjct: 61 MNIPSNYHVLFMHGGGRGQFAAVVNNLLGEQGKALYLVDGSWSSAAVEEAKKLAGDAQID 120 Query: 121 AKVTVD---GLRAVKPMREWQLSDNAAYMHYCPNETIDGIAIDETPDFGADVVVAADFSS 177 V+ G+ + ++ + Y+HYCPNET+DGI I E + + + AD SS Sbjct: 121 TLNIVEKTNGISRIVVPDLNEIKQDYRYLHYCPNETVDGIEIFE--EINSPWPIVADMSS 178 Query: 178 TILSRPIDVSRYGVIYAGAQKNIGPAGLTIVIVREDLLGKANIACPSILDYSILNDNGSM 237 I+SR IDVSRYG+IYAGAQKNIGP+GL+IVIVR+DLL + SI+DY + + SM Sbjct: 179 NIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDLLAYPQLTQASIMDYRLAVKHDSM 238 Query: 238 FNTPPTFAWYLSGLVFKWLKANGGVAEMDKINQQKAELLYGVIDNSDFYRNDVAKANRSR 297 FNTPPTFAWYL+ VFKWLKA GGVAE+ K+N +KAE LY ID+ DFY N VA ANRS+ Sbjct: 239 FNTPPTFAWYLAAEVFKWLKAQGGVAEVAKVNDRKAETLYAYIDSGDFYENRVAVANRSK 298 Query: 298 MNVPFQLADSALDKLFLEESFAAGLHALKGHRVVGGMRASIYNAMPLEGVKALTDFMVEF 357 MNV F L D +L++ FL E+ AAGL ALKGHR VGGMRAS+YNAMPL GV+AL FM F Sbjct: 299 MNVTFYLKDESLNEPFLAEAKAAGLVALKGHRSVGGMRASLYNAMPLVGVEALVSFMKAF 358 Query: 358 ERRH 361 +H Sbjct: 359 AEKH 362 Lambda K H 0.319 0.136 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 394 Number of extensions: 13 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 364 Length adjustment: 29 Effective length of query: 333 Effective length of database: 335 Effective search space: 111555 Effective search space used: 111555 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
Align candidate 5209480 Shew_1950 (phosphoserine aminotransferase (RefSeq))
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01364.hmm # target sequence database: /tmp/gapView.8663.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01364 [M=358] Accession: TIGR01364 Description: serC_1: phosphoserine transaminase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 4.8e-152 491.9 0.0 5.4e-152 491.7 0.0 1.0 1 lcl|FitnessBrowser__PV4:5209480 Shew_1950 phosphoserine aminotra Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5209480 Shew_1950 phosphoserine aminotransferase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 491.7 0.0 5.4e-152 5.4e-152 2 358 .] 5 362 .. 4 362 .. 0.97 Alignments for each domain: == domain 1 score: 491.7 bits; conditional E-value: 5.4e-152 TIGR01364 2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlflqGGattqfaa 79 +nF+aGPa+lp+ v++kaq+elld+ng+g+svmeisHRskef +++e+ae d+r+L+nip+ny+vlf+ GG+++qfaa lcl|FitnessBrowser__PV4:5209480 5 YNFCAGPAMLPQPVMQKAQEELLDWNGQGVSVMEISHRSKEFIALTEQAEADIRDLMNIPSNYHVLFMHGGGRGQFAA 82 8***************************************************************************** PP TIGR01364 80 vplnllkekkvadyivtGawskkalkeakkltk..evkvvase.eekkyskipdeeelelkedaayvylcanetieGv 154 v nll e+ +a y+v G+ws+ a++eakkl ++++++ +++ s+i + e+k+d+ y+++c net++G+ lcl|FitnessBrowser__PV4:5209480 83 VVNNLLGEQGKALYLVDGSWSSAAVEEAKKLAGdaQIDTLNIVeKTNGISRIVVPDLNEIKQDYRYLHYCPNETVDGI 160 *******************************9877666555443778899999999999******************* PP TIGR01364 155 efkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvivrkdllerakkelpsvldYkilaends 232 e+ e+ ++ p+vaD+ss+i+sr+idvs+ygliyaGaqKniGp+G+++vivr+dll+ + + +s++dY+ ++++ds lcl|FitnessBrowser__PV4:5209480 161 EIFEEI-NSPWPIVADMSSNIMSREIDVSRYGLIYAGAQKNIGPSGLSIVIVRDDLLAYPQLTQASIMDYRLAVKHDS 237 ***999.789******************************************************************** PP TIGR01364 233 lyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllYeaidesegfyknkvekkaRslmnvvFtlkkeelekeF 310 ++ntpptfa+y+++ v+kwlk++GGv++++k n +Ka+ lY +id+ +fy+n+v+ ++Rs+mnv+F lk+e l++ F lcl|FitnessBrowser__PV4:5209480 238 MFNTPPTFAWYLAAEVFKWLKAQGGVAEVAKVNDRKAETLYAYIDSG-DFYENRVAVANRSKMNVTFYLKDESLNEPF 314 *********************************************65.6***************************** PP TIGR01364 311 lkeaeekglvslkGhrsvGGiRasiYnalpleevqaLvdfmkeFekkh 358 l+ea+++glv+lkGhrsvGG+Ras+Yna+pl +v+aLv+fmk F++kh lcl|FitnessBrowser__PV4:5209480 315 LAEAKAAGLVALKGHRSVGGMRASLYNAMPLVGVEALVSFMKAFAEKH 362 *********************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (358 nodes) Target sequences: 1 (364 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 7.02 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory