Align anthranilate synthase (subunit 2/2) (EC 4.1.3.27) (characterized)
to candidate 5211261 Shew_3677 isochorismate synthase (RefSeq)
Query= BRENDA::Q06128 (421 letters) >FitnessBrowser__PV4:5211261 Length = 452 Score = 120 bits (300), Expect = 1e-31 Identities = 87/273 (31%), Positives = 136/273 (49%), Gaps = 19/273 (6%) Query: 151 YDESLNKNSYERIVSESLEYIRSGYIFQVVLSRFYRYIFSG--DPLRIYYNLRRINPSPY 208 + E +N+ +++R + ++ + VVLSR + + DP + + + N + + Sbjct: 191 WHELVNQVTHDRFIQDTPK---------VVLSRLTQLEVNEKVDPWMLLASWQGRNQNSF 241 Query: 209 MFYLKFD-EKYLIGSSPELLFRVQDNIVETYPIAGTRPRGADQEEDLKLELELMNSEKDK 267 F +F E I +PE L+R + V T +AGT RG ++ ED L +L++ K+ Sbjct: 242 QFGFQFSPESAFISCTPERLYRRRQREVFTEALAGTTTRGLNEAEDAMLAQQLLDDTKNS 301 Query: 268 AEHLMLVDLARNDLGKVCVP--GTVKVPELMYVEKYSHVQHIVSKVIGTLKKKYNALNVL 325 E+ L R + P V EL V K SH+QH+ + LK N +L Sbjct: 302 HEN----QLVREHIVDALTPLSNYVGADELAKVFKLSHIQHLHRAIRAELKPGVNDFQIL 357 Query: 326 SATFPAGTVSGAPKPMAMNIIETLEEYKRGPYAGAVGFISADGNAEFAIAIRTAFLNKEL 385 A P V G PK A+N I E Y RG YAGA G+ + +EFA+AIR+A + Sbjct: 358 QALHPTPAVGGLPKASAINFIRQREGYTRGWYAGACGYFN-KYESEFAVAIRSALIEPGR 416 Query: 386 LRIHAGAGIVYDSNPESEYFETEHKLKALKTAI 418 + + AGAGIV S E+E+ E E+KLK + + + Sbjct: 417 INLFAGAGIVSGSEAEAEWNELENKLKTIMSIL 449 Lambda K H 0.319 0.139 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 380 Number of extensions: 20 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 421 Length of database: 452 Length adjustment: 32 Effective length of query: 389 Effective length of database: 420 Effective search space: 163380 Effective search space used: 163380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory