Align fused chorismate mutase/prephenate dehydrogenase (EC 5.4.99.5; EC 1.3.1.12) (characterized)
to candidate 5208557 Shew_1068 bifunctional chorismate mutase/prephenate dehydrogenase (RefSeq)
Query= ecocyc::CHORISMUTPREPHENDEHYDROG-MONOMER (373 letters) >FitnessBrowser__PV4:5208557 Length = 384 Score = 421 bits (1082), Expect = e-122 Identities = 214/368 (58%), Positives = 268/368 (72%), Gaps = 1/368 (0%) Query: 4 ELTALRDQIDEVDKALLNLLAKRLELVAEVGEVKSRFGLPIYVPEREASMLASRRAEAEA 63 EL LR+ ID VD+ LL+LL KRL+LVA+VG VK G+PIY P+REASMLA RR EA Sbjct: 13 ELEKLREHIDSVDQQLLHLLRKRLDLVAQVGGVKHAAGVPIYAPQREASMLAKRREEAAK 72 Query: 64 LGVPPDLIEDVLRRVMRESYSSENDKGFKTLCPSLRPVVIVGGGGQMGRLFEKMLTLSGY 123 + V P LIED+LRR+MRESY +E D GFK + L VVIVGG G++G LF +ML+LSGY Sbjct: 73 MNVSPQLIEDILRRLMRESYLNEKDVGFKQVKTDLGHVVIVGGQGKLGGLFAQMLSLSGY 132 Query: 124 QVRILEQHDWDRAADIVADAGMVIVSVPIHVTEQVI-GKLPPLPKDCILVDLASVKNGPL 182 QV+ L++ DW +A I AGMVIV+VPI +T ++I KL LP CIL DL S+K PL Sbjct: 133 QVKSLDKDDWQQADAIFDGAGMVIVTVPISITCELIRDKLTSLPSSCILADLTSIKEKPL 192 Query: 183 QAMLVAHDGPVLGLHPMFGPDSGSLAKQVVVWCDGRKPEAYQWFLEQIQVWGARLHRISA 242 +AML +H GPV+GLHPMFGPD GSLAKQVVV C GR E Y+W LEQI +WGARL A Sbjct: 193 EAMLASHQGPVVGLHPMFGPDVGSLAKQVVVVCHGRGREQYEWLLEQIGIWGARLVEADA 252 Query: 243 VEHDQNMAFIQALRHFATFAYGLHLAEENVQLEQLLALSSPIYRLELAMVGRLFAQDPQL 302 +HD+ M +QA+RHF++F YGL+L E ++ LL SSPIYRLELAMVGRLFAQ P+L Sbjct: 253 QQHDKAMQLVQAMRHFSSFVYGLNLYREAADIDNLLQFSSPIYRLELAMVGRLFAQSPEL 312 Query: 303 YADIIMSSERNLALIKRYYKRFGEAIELLEQGDKQAFIDSFRKVEHWFGDYAQRFQSESR 362 YADII + + +L I Y + +A+ELL++GD+Q FI F +V WFGD+A +FQ ESR Sbjct: 313 YADIIFAQQESLTAIGDYLDNYAQALELLKRGDRQGFIREFEEVAAWFGDFAPQFQRESR 372 Query: 363 VLLRQAND 370 +L+ ND Sbjct: 373 AMLQSVND 380 Lambda K H 0.322 0.138 0.404 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 404 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 373 Length of database: 384 Length adjustment: 30 Effective length of query: 343 Effective length of database: 354 Effective search space: 121422 Effective search space used: 121422 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 50 (23.9 bits)
Align candidate 5208557 Shew_1068 (bifunctional chorismate mutase/prephenate dehydrogenase (RefSeq))
to HMM TIGR01799 (tyrA: chorismate mutase (EC 5.4.99.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01799.hmm # target sequence database: /tmp/gapView.29038.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01799 [M=83] Accession: TIGR01799 Description: CM_T: chorismate mutase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 1.5e-47 145.9 1.9 4.1e-47 144.5 1.9 1.8 1 lcl|FitnessBrowser__PV4:5208557 Shew_1068 bifunctional chorismat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__PV4:5208557 Shew_1068 bifunctional chorismate mutase/prephenate dehydrogenase (RefSeq) # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 144.5 1.9 4.1e-47 4.1e-47 1 83 [] 14 96 .. 14 96 .. 0.99 Alignments for each domain: == domain 1 score: 144.5 bits; conditional E-value: 4.1e-47 TIGR01799 1 lkdlrdeidevdkellqllakrlelvaqvGkvkhraGlPiyaPereaamlakrreeaeklGiapdliedvlrrlmresya 80 l++lr++id+vd++ll+ll+krl+lvaqvG vkh+aG+PiyaP+rea+mlakrreea k+ ++p+lied+lrrlmresy+ lcl|FitnessBrowser__PV4:5208557 14 LEKLREHIDSVDQQLLHLLRKRLDLVAQVGGVKHAAGVPIYAPQREASMLAKRREEAAKMNVSPQLIEDILRRLMRESYL 93 799***************************************************************************** PP TIGR01799 81 nen 83 ne+ lcl|FitnessBrowser__PV4:5208557 94 NEK 96 *97 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (83 nodes) Target sequences: 1 (384 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00 # Mc/sec: 8.54 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory