GapMind for Amino acid biosynthesis

 

Aligments for a candidate for ilvE in Shewanella loihica PV-4

Align branched-chain-amino-acid transaminase (EC 2.6.1.42) (characterized)
to candidate 5207770 Shew_0291 branched-chain amino acid aminotransferase (RefSeq)

Query= BRENDA::P0AB80
         (309 letters)



>lcl|FitnessBrowser__PV4:5207770 Shew_0291 branched-chain amino acid
           aminotransferase (RefSeq)
          Length = 307

 Score =  429 bits (1102), Expect = e-125
 Identities = 202/305 (66%), Positives = 246/305 (80%)

Query: 1   MTTKKADYIWFNGEMVRWEDAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR 60
           M  K A+ IWFNGE++ W DAKVHVMSHALHYGTSVFEGIR YD+ +GP  FR  +H+QR
Sbjct: 1   MAAKTAELIWFNGEIMPWGDAKVHVMSHALHYGTSVFEGIRVYDTPQGPAGFRLTDHVQR 60

Query: 61  LHDSAKIYRFPVSQSIDELMEACRDVIRKNNLTSAYIRPLIFVGDVGMGVNPPAGYSTDV 120
           L+DSAKIYR PV  S DE M+ACRD+++ N L +AYIRPL+F GDVGMG+ PP     D+
Sbjct: 61  LYDSAKIYRMPVPYSFDETMQACRDIVKSNKLDAAYIRPLVFFGDVGMGITPPKDAKCDL 120

Query: 121 IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY 180
           ++AAFPWGAYLG  ++E+G+D  V+SWNR APNTIPT AKAGGNYLSSL + +EA+R+G+
Sbjct: 121 MVAAFPWGAYLGEGSMERGVDVAVTSWNRLAPNTIPTGAKAGGNYLSSLQISTEAKRNGF 180

Query: 181 QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKELGIEVREQ 240
            EGIALDVNG +SEGAG NLF VK   L+TPP T++ L GITRD II LA++LG EV E+
Sbjct: 181 DEGIALDVNGLVSEGAGANLFVVKKNKLYTPPATAAILLGITRDTIITLARDLGYEVVEE 240

Query: 241 VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGEGRCGPVTKRIQQAFFGLFTGETEDK 300
            +SRE LYLADE+FM+GTAAEI PVRSVD I+VG G  GPVT+ +Q +FFGLF GET+DK
Sbjct: 241 PMSREFLYLADEIFMTGTAAEIVPVRSVDRIEVGAGGRGPVTQALQASFFGLFNGETQDK 300

Query: 301 WGWLD 305
           WGWL+
Sbjct: 301 WGWLE 305


Lambda     K      H
   0.319    0.136    0.413 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 366
Number of extensions: 9
Number of successful extensions: 1
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 309
Length of database: 307
Length adjustment: 27
Effective length of query: 282
Effective length of database: 280
Effective search space:    78960
Effective search space used:    78960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 48 (23.1 bits)

Align candidate 5207770 Shew_0291 (branched-chain amino acid aminotransferase (RefSeq))
to HMM TIGR01122 (ilvE: branched-chain amino acid aminotransferase (EC 2.6.1.42))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01122.hmm
# target sequence database:        /tmp/gapView.5450.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01122  [M=298]
Accession:   TIGR01122
Description: ilvE_I: branched-chain amino acid aminotransferase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                        Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                        -----------
     1e-132  427.8   0.0   1.1e-132  427.7   0.0    1.0  1  lcl|FitnessBrowser__PV4:5207770  Shew_0291 branched-chain amino a


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__PV4:5207770  Shew_0291 branched-chain amino acid aminotransferase (RefSeq)
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  427.7   0.0  1.1e-132  1.1e-132       1     296 [.      10     305 ..      10     307 .] 1.00

  Alignments for each domain:
  == domain 1  score: 427.7 bits;  conditional E-value: 1.1e-132
                        TIGR01122   1 wldGelvdvedakvhvlthalhYGtgvfeGiRaYetdkglaifrlkehveRlydsakilrleipyskeelvevtkevl 78 
                                      w++Ge++++ dakvhv++halhYGt+vfeGiR+Y+t++g+a frl++hv+Rlydsaki+r+++pys +e ++++++++
  lcl|FitnessBrowser__PV4:5207770  10 WFNGEIMPWGDAKVHVMSHALHYGTSVFEGIRVYDTPQGPAGFRLTDHVQRLYDSAKIYRMPVPYSFDETMQACRDIV 87 
                                      9***************************************************************************** PP

                        TIGR01122  79 rknnlksaYiRplvyvGaedlglkpkvdlkveviiaawewgaylgeealekGikvkvssfrraavnsiptkakaagnY 156
                                      ++n+l+ aYiRplv+ G+ ++g++p+ d+k ++++aa++wgaylge ++e+G++v v+s++r a+n+ipt aka+gnY
  lcl|FitnessBrowser__PV4:5207770  88 KSNKLDAAYIRPLVFFGDVGMGITPPKDAKCDLMVAAFPWGAYLGEGSMERGVDVAVTSWNRLAPNTIPTGAKAGGNY 165
                                      ****************************************************************************** PP

                        TIGR01122 157 lnsllaksealraGydeailLdeeGyvaeGsGenifivkdgvlltPpvsesiLkgitrdaviklakelgievkeeris 234
                                      l+sl + +ea+r+G+de+i+Ld +G v+eG+G n+f+vk+++l+tPp + +iL gitrd++i+la++lg+ev+ee++s
  lcl|FitnessBrowser__PV4:5207770 166 LSSLQISTEAKRNGFDEGIALDVNGLVSEGAGANLFVVKKNKLYTPPATAAILLGITRDTIITLARDLGYEVVEEPMS 243
                                      ****************************************************************************** PP

                        TIGR01122 235 reelytaDevfltGtaaevtPirevDgrkigegkrGpvtkklqeaffdlvegktekkeewlt 296
                                      re ly+aDe+f+tGtaae++P+r+vD +++g+g rGpvt+ lq +ff l++g+t++k++wl+
  lcl|FitnessBrowser__PV4:5207770 244 REFLYLADEIFMTGTAAEIVPVRSVDRIEVGAGGRGPVTQALQASFFGLFNGETQDKWGWLE 305
                                      ************************************************************97 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (298 nodes)
Target sequences:                          1  (307 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.86
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory