Align acetolactate synthase (subunit 1/2) (EC 2.2.1.6) (characterized)
to candidate 5209297 Shew_1775 acetolactate synthase 3 regulatory subunit (RefSeq)
Query= BRENDA::P00894 (163 letters) >FitnessBrowser__PV4:5209297 Length = 164 Score = 235 bits (599), Expect = 3e-67 Identities = 114/163 (69%), Positives = 141/163 (86%) Query: 1 MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKVLEQI 60 MRRI+SVLLEN+ GALSRV+GLFSQRGYNIESLTVAPTDD TLSR+ I V DE VLEQI Sbjct: 1 MRRIISVLLENQPGALSRVVGLFSQRGYNIESLTVAPTDDVTLSRLNITLVADEAVLEQI 60 Query: 61 EKQLHKLVDVLRVSELGQGAHVEREIMLVKIQASGYGRDEVKRNTEIFRGQIIDVTPSLY 120 EKQLHKL+D+L+VS + + +H+ERE+ L+K++A G GR+EVKR +IFRGQI+DVT LY Sbjct: 61 EKQLHKLIDILKVSNITESSHIERELALIKVKAKGAGREEVKRTADIFRGQIVDVTSELY 120 Query: 121 TVQLAGTSGKLDAFLASIRDVAKIVEVARSGVVGLSRGDKIMR 163 T+Q+AGTS KLDAF+A+I +V K++EV+RSGVVGL RG+K MR Sbjct: 121 TIQMAGTSDKLDAFIAAIGEVTKVIEVSRSGVVGLCRGEKAMR 163 Lambda K H 0.318 0.136 0.360 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 132 Number of extensions: 1 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 163 Length of database: 164 Length adjustment: 18 Effective length of query: 145 Effective length of database: 146 Effective search space: 21170 Effective search space used: 21170 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 43 (21.2 bits)
Align candidate 5209297 Shew_1775 (acetolactate synthase 3 regulatory subunit (RefSeq))
to HMM TIGR00119 (ilvN: acetolactate synthase, small subunit (EC 2.2.1.6))
../bin/blast/fastacmd -i /tmp/list.20694.in -d ../tmp/orgsFit/orgs.faa -p T > /tmp/gapView.20694.genome.faa failed: Inappropriate ioctl for device at ../lib/pbutils.pm line 379.
For help, please send mail to the webmaster (help@microbesonline.org), giving this error message and the time and date of the error.