Align Carbamoyl-phosphate synthase small chain; Carbamoyl-phosphate synthetase glutamine chain; EC 6.3.5.5 (characterized)
to candidate CA265_RS15240 CA265_RS15240 carbamoyl phosphate synthase small subunit
Query= SwissProt::P0A6F1 (382 letters) >FitnessBrowser__Pedo557:CA265_RS15240 Length = 370 Score = 310 bits (794), Expect = 4e-89 Identities = 167/373 (44%), Positives = 229/373 (61%), Gaps = 18/373 (4%) Query: 5 ALLVLEDGTQFHGRAIGATGSAVGEVVFNTSMTGYQEILTDPSYSRQIVTLTYPHIGNVG 64 A+L+L DGT F+G+A G G+ GE+ FNT MTGYQEI TDPSY QI+ T HIGN G Sbjct: 9 AILLLADGTVFYGKAAGKIGTTTGEICFNTGMTGYQEIFTDPSYFGQIMVTTNAHIGNYG 68 Query: 65 TNDADEESSQVHAQGLVIRDLPLIASNFRNTEDLSSYLKRHNIVAIADIDTRKLTRLLRE 124 + + ES + GLV ++ ++ S TE + Y + N+VAI+DIDTR L R +R+ Sbjct: 69 IHKDEIESGSIKIAGLVCKNYNIVYSRKEATESIQDYFQNDNLVAISDIDTRALVRHIRD 128 Query: 125 KGAQNGCIIAGDNPDAALALEKARAFPGLNGMDLAKEVTTAEAYSWTQGSWTLTGGLPEA 184 KGA N II+ + D +K P + G++L+ +V+T E Y + G PEA Sbjct: 129 KGAMNA-IISSEITDLEELKQKLAEVPSMEGLELSSKVSTTEPYFY---------GNPEA 178 Query: 185 KKEDELPFHVVAYDFGAKRNILRMLVDRGCRLTIVPAQTSAEDVLKMNPDGIFLSNGPGD 244 + V A D G K+NILR +R + + PA+TS ++ K +PDG F+SNGPGD Sbjct: 179 SLK------VAALDLGIKKNILRNFENRDIYVQVFPAKTSFAEMEKFSPDGYFISNGPGD 232 Query: 245 PAPCDYAITAIQKFLETDIPVFGICLGHQLLALASGAKTVKMKFGHHGGNHPVKDVEKNV 304 P+ YA+ I L D P+FGICLGHQLLA A+G T+KM GH G NHPVK++ KN Sbjct: 233 PSVMPYAVETITAILAVDKPLFGICLGHQLLAEANGIGTMKMFNGHRGLNHPVKNIIKNH 292 Query: 305 VMITAQNHGFAV--DEATLPANLRVTHKSLFDGTLQGIHRTDKPAFSFQGHPEASPGPHD 362 +T+QNHGF V DE + +TH +L D +++GI K AFS Q HPE+SPGPHD Sbjct: 293 CEVTSQNHGFGVIPDEVRNSDKVEITHVNLNDKSIEGIRVKGKKAFSVQYHPESSPGPHD 352 Query: 363 AAPLFDHFIELIE 375 + LFD F+++++ Sbjct: 353 SRYLFDDFVDVMK 365 Lambda K H 0.318 0.135 0.400 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 386 Number of extensions: 16 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 382 Length of database: 370 Length adjustment: 30 Effective length of query: 352 Effective length of database: 340 Effective search space: 119680 Effective search space used: 119680 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS15240 CA265_RS15240 (carbamoyl phosphate synthase small subunit)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.32671.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 3e-141 456.5 0.4 3.4e-141 456.3 0.4 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS15240 CA265_RS15240 carbamoyl phosphat Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS15240 CA265_RS15240 carbamoyl phosphate synthase small subunit # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 456.3 0.4 3.4e-141 3.4e-141 1 360 [. 9 365 .. 9 366 .. 0.98 Alignments for each domain: == domain 1 score: 456.3 bits; conditional E-value: 3.4e-141 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaes 68 a+l+l+dGtvf gk+ g+ ++++Ge++FnT+mtGYqEi+tDpsY gqi+v t+ +ignyg++++++es lcl|FitnessBrowser__Pedo557:CA265_RS15240 9 AILLLADGTVFYGKAAGKIGTTTGEICFNTGMTGYQEIFTDPSYFGQIMVTTNAHIGNYGIHKDEIES 76 689***************************************************************** PP TIGR01368 69 kkikvkglvvkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekseke 136 +ik++glv k+++ +s +a+es+++++++ ++vai ++DTRalv+++R+kg+m+a+is+e ++ e lcl|FitnessBrowser__Pedo557:CA265_RS15240 77 GSIKIAGLVCKNYNIVYSRKEATESIQDYFQNDNLVAISDIDTRALVRHIRDKGAMNAIISSEITDLE 144 ******************************************************************** PP TIGR01368 137 elvekakespkvkevnlvkevstkeayeleqkakkegkklrvvvidlGvKenilreLvkrgvevtvvp 204 el++k++e p++++++l ++vst+e+y + + + +l+v+++dlG+K+nilr++ +r++ v+v+p lcl|FitnessBrowser__Pedo557:CA265_RS15240 145 ELKQKLAEVPSMEGLELSSKVSTTEPYFYGN----PEASLKVAALDLGIKKNILRNFENRDIYVQVFP 208 ***************************9995....677789*************************** PP TIGR01368 205 adtsaeeikklnpdgillsnGPGdPaaveeaietvkklleakiPifGIclGhqllalalgaktyklkf 272 a+ts++e++k++pdg ++snGPGdP+ + +a+et+ ++l ++P+fGIclGhqlla a g t+k+ lcl|FitnessBrowser__Pedo557:CA265_RS15240 209 AKTSFAEMEKFSPDGYFISNGPGDPSVMPYAVETITAILAVDKPLFGICLGHQLLAEANGIGTMKMFN 276 ******************************************************************** PP TIGR01368 273 GhrGaNhpvkdlktgrveitsqNHgyavdeeslk.eeelevthvnlnDgtveglehkelpvfsvQyHP 339 GhrG Nhpvk+++++++e+tsqNHg+ v ++ ++ ++++e+thvnlnD+++eg++ k +++fsvQyHP lcl|FitnessBrowser__Pedo557:CA265_RS15240 277 GHRGLNHPVKNIIKNHCEVTSQNHGFGVIPDEVRnSDKVEITHVNLNDKSIEGIRVKGKKAFSVQYHP 344 ***************************99988851678****************************** PP TIGR01368 340 easpGphdteylFdefvelik 360 e+spGphd++ylFd+fv+ +k lcl|FitnessBrowser__Pedo557:CA265_RS15240 345 ESSPGPHDSRYLFDDFVDVMK 365 *****************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (370 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 9.54 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory