Align Shikimate kinase; Short=SK; EC 2.7.1.71 (characterized, see rationale)
to candidate CA265_RS25310 CA265_RS25310 shikimate kinase
Query= uniprot:AROK_BACTN (175 letters) >FitnessBrowser__Pedo557:CA265_RS25310 Length = 167 Score = 145 bits (365), Expect = 5e-40 Identities = 74/167 (44%), Positives = 112/167 (67%), Gaps = 2/167 (1%) Query: 2 VRIFLTGYMGAGKTTLGKAFARKLNVPFIDLDWYIEERFHKTVGELFTERGEAGFRELER 61 ++IFL GYMG GK+T K A +L+ P IDLD I + K++ E F E GE+GFR+ E Sbjct: 1 MKIFLIGYMGCGKSTKAKQLAHRLDCPVIDLDAEIVSKTGKSIAEYFAEYGESGFRDYES 60 Query: 62 NMLHEVAEFENVVISTGGGAPCFYDNMEFMNRTGKTVFLNVHPDVLFRRLRIAKQQRPIL 121 ML E V++TGGG PCF+DNME+MN G+TV+L + P L RL +Q+RP++ Sbjct: 61 EMLKTFDYPETCVVATGGGLPCFFDNMEWMNANGETVYLQMEPAALVSRLH-NRQKRPLI 119 Query: 122 QGKEDDELMDFIIQALEKRAPFYTQAQYIFNADELEDRWQIESSVQR 168 + +D++L+ FI + LE+R PFYT+A+ I +A +L D ++E ++++ Sbjct: 120 KDLDDEQLLVFIKEKLEERDPFYTRAKLIVDAFDL-DGEKLEEAIKK 165 Lambda K H 0.324 0.141 0.416 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 104 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 175 Length of database: 167 Length adjustment: 18 Effective length of query: 157 Effective length of database: 149 Effective search space: 23393 Effective search space used: 23393 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (22.0 bits) S2: 43 (21.2 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory