GapMind for Amino acid biosynthesis

 

Aligments for a candidate for hisF in Pedobacter sp. GW460-11-11-14-LB5

Align Imidazole glycerol phosphate synthase subunit HisF; IGP synthase cyclase subunit; IGP synthase subunit HisF; ImGP synthase subunit HisF; IGPS subunit HisF; EC 4.3.2.10 (characterized)
to candidate CA265_RS03610 CA265_RS03610 imidazole glycerol phosphate synthase subunit HisF

Query= SwissProt::Q7SIB9
         (252 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS03610 CA265_RS03610 imidazole
           glycerol phosphate synthase subunit HisF
          Length = 379

 Score =  278 bits (710), Expect = 2e-79
 Identities = 143/250 (57%), Positives = 179/250 (71%), Gaps = 1/250 (0%)

Query: 3   LAKRIVPCLDVHAGRVVKGVNFVNLRDAGDPVEAARAYDEAGADELVFLDISATHEERAI 62
           L+KRI+PCLDV  GR VKGVNFV+LRDAGDPVE A  Y + GADELVFLDI+ATHE R  
Sbjct: 130 LSKRIIPCLDVKDGRTVKGVNFVDLRDAGDPVELAAQYAQQGADELVFLDITATHERRKT 189

Query: 63  LLDVVARVAERVFIPLTVGGGVRSLEDARKLLLSGADKVSVNSAAVRRPELIRELADHFG 122
           ++++V  VA ++ IP T+GGG+  + DA  LL +GADK+S+NSAAVR P+LI +LA  FG
Sbjct: 190 MIEMVKSVARQLNIPFTIGGGITEIADAEALLNAGADKISINSAAVRNPKLIEDLAKTFG 249

Query: 123 AQAVVLAIDARWRGDFPEVHVAGGRVPTGLHAVEWAVKGVELGAGEILLTSMDRDGTKEG 182
            Q VVLA+D ++      VH+ GGR+ T L    W  +  +LGAGEILLTSMD DGTK G
Sbjct: 250 VQFVVLAVDTKYVDGKNMVHLNGGRLITELETENWIKQAEDLGAGEILLTSMDHDGTKAG 309

Query: 183 YDLRLTRMVAEAVGVPVIASGGAGRMEHFLEAFQ-AGAEAALAASVFHFGEIPIPKLKRY 241
           +D  L   V + + +P+IASGGAG M HF E FQ A  +AALAASVFH+GEI IP LK+ 
Sbjct: 310 FDCGLLSKVNQMINIPIIASGGAGNMAHFTEVFQKANVDAALAASVFHYGEILIPDLKQE 369

Query: 242 LAEKGVHVRL 251
           L    + VR+
Sbjct: 370 LKRNNIPVRI 379


Lambda     K      H
   0.321    0.138    0.398 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 268
Number of extensions: 13
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 252
Length of database: 379
Length adjustment: 27
Effective length of query: 225
Effective length of database: 352
Effective search space:    79200
Effective search space used:    79200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 48 (23.1 bits)

Align candidate CA265_RS03610 CA265_RS03610 (imidazole glycerol phosphate synthase subunit HisF)
to HMM TIGR00735 (hisF: imidazoleglycerol phosphate synthase, cyclase subunit)

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00735.hmm
# target sequence database:        /tmp/gapView.15262.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00735  [M=254]
Accession:   TIGR00735
Description: hisF: imidazoleglycerol phosphate synthase, cyclase subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   1.1e-108  348.3   0.7   1.4e-108  348.0   0.7    1.1  1  lcl|FitnessBrowser__Pedo557:CA265_RS03610  CA265_RS03610 imidazole glycerol


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS03610  CA265_RS03610 imidazole glycerol phosphate synthase subunit HisF
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  348.0   0.7  1.4e-108  1.4e-108       2     254 .]     130     378 ..     129     378 .. 0.99

  Alignments for each domain:
  == domain 1  score: 348.0 bits;  conditional E-value: 1.4e-108
                                  TIGR00735   2 lakriipCLdvkdgrvvkGvqfknlrdaGdpvelakkydeeGadelvflditassekretmlevverv 69 
                                                l+kriipCLdvkdgr vkGv+f +lrdaGdpvela++y+++Gadelvfldita++e+r+tm+e+v+ v
  lcl|FitnessBrowser__Pedo557:CA265_RS03610 130 LSKRIIPCLDVKDGRTVKGVNFVDLRDAGDPVELAAQYAQQGADELVFLDITATHERRKTMIEMVKSV 197
                                                89****************************************************************** PP

                                  TIGR00735  70 aekvfiPltvgGGiksiedvkkllraGadkvsintaavkapelikeladrfGsqaivvaidakreaen 137
                                                a+++ iP+t+gGGi +i+d++ ll+aGadk+sin+aav++p+li++la++fG+q +v+a+d+k++   
  lcl|FitnessBrowser__Pedo557:CA265_RS03610 198 ARQLNIPFTIGGGITEIADAEALLNAGADKISINSAAVRNPKLIEDLAKTFGVQFVVLAVDTKYVDG- 264
                                                ***************************************************************9875. PP

                                  TIGR00735 138 eeakyevtikgGrestdldvvewakeveelGaGeilltsmdkdGtksGydlellkkvkeavkiPvias 205
                                                   k  v+ +gGr  t+l++ +w+k++e+lGaGeilltsmd+dGtk+G+d  ll kv++ ++iP+ias
  lcl|FitnessBrowser__Pedo557:CA265_RS03610 265 ---KNMVHLNGGRLITELETENWIKQAEDLGAGEILLTSMDHDGTKAGFDCGLLSKVNQMINIPIIAS 329
                                                ...5689************************************************************* PP

                                  TIGR00735 206 gGaGkaehleeaflkgkadaaLaasvfhkreltieevkeylaergvkvr 254
                                                gGaG++ h++e+f+k+++daaLaasvfh++e+ i ++k+ l+ ++++vr
  lcl|FitnessBrowser__Pedo557:CA265_RS03610 330 GGAGNMAHFTEVFQKANVDAALAASVFHYGEILIPDLKQELKRNNIPVR 378
                                                ***********************************************98 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (254 nodes)
Target sequences:                          1  (379 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.00
# Mc/sec: 9.79
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory