GapMind for Amino acid biosynthesis

 

Aligments for a candidate for cimA in Pedobacter sp. GW460-11-11-14-LB5

Align (R)-citramalate synthase CimA; EC 2.3.1.182 (characterized)
to candidate CA265_RS15855 CA265_RS15855 2-isopropylmalate synthase

Query= SwissProt::Q58787
         (491 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS15855 CA265_RS15855
           2-isopropylmalate synthase
          Length = 386

 Score =  283 bits (725), Expect = 6e-81
 Identities = 166/374 (44%), Positives = 222/374 (59%), Gaps = 11/374 (2%)

Query: 3   VRIFDTTLRDGEQTPGVSLTPNDKLEIAKKLDELGVDVIEAGSAITSKGEREGIKLITKE 62
           V IFDTTLRDGEQ PG  L  N K+EIAK L+ LGVDVIEAG  ++S G+   +  ++K 
Sbjct: 8   VYIFDTTLRDGEQVPGCQLDTNQKVEIAKSLELLGVDVIEAGFPVSSPGDFNSVIELSKA 67

Query: 63  GLNAEICSFVRALPVDIDAALE----CDVDSVHLVVPTSPIHMKYKLRKTEDEVLETALK 118
             N  IC+  RA   DID A +         +H  + +S  H+K+K   T +E+LE A++
Sbjct: 68  VTNPIICALTRANKNDIDVAADALRYAKRPRIHTGIGSSDFHIKHKFNSTREEILERAVE 127

Query: 119 AVEYAKEHGLIVELSAEDATRSDVNFLIKLFNEGEKVGADRVCVCDTVGVLTPQKSQELF 178
           AV Y+K+    VE  AEDA R+D+ FL K+       GA  V + DT G   P +     
Sbjct: 128 AVRYSKKFVEDVEFYAEDAGRADIEFLAKMVEAVIAAGATVVNIPDTNGYCLPDQYGSKI 187

Query: 179 KKITENV----NLPVSVHCHNDFGMATANTCSAVLGGAVQCHVTVNGIGERAGNASLEEV 234
             + ENV       +SVHCHND G+ATAN+ + +  GA Q   T+NGIGERAGN S+EEV
Sbjct: 188 LFLKENVKNIDKAIISVHCHNDLGLATANSIAGLQNGARQVECTINGIGERAGNTSMEEV 247

Query: 235 VAALKI--LYGYDTKIKMEKLYEVSRIVSRLMKLPVPPNKAIVGDNAFAHEAGIHVDGLI 292
           V  LK   + G +T+I   + YE+S +V   M +PV PNKAIVG NAF+H +GIH DG +
Sbjct: 248 VMILKTHKILGLNTQIDATRFYEMSHMVRNQMNMPVQPNKAIVGGNAFSHSSGIHQDGFL 307

Query: 293 KNTETYEPIKPEMVG-NRRRIILGKHSGRKALKYKLDLMGINVSDEQLNKIYERVKEFGD 351
           KN E YE IKPE VG     I+L   SGR ALK+ LD +G  +  + L+ +Y++     D
Sbjct: 308 KNRENYEIIKPEDVGFPDATIVLTARSGRHALKHHLDRLGHKLEKDHLDIVYKQFLVLAD 367

Query: 352 LGKYISDADLLAIV 365
             + I+D DL  +V
Sbjct: 368 SKQGINDQDLNQLV 381


Lambda     K      H
   0.316    0.136    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 481
Number of extensions: 31
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 491
Length of database: 386
Length adjustment: 32
Effective length of query: 459
Effective length of database: 354
Effective search space:   162486
Effective search space used:   162486
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory