GapMind for Amino acid biosynthesis

 

Aligments for a candidate for leuC in Pedobacter sp. GW460-11-11-14-LB5

Align 3-isopropylmalate dehydratase large subunit; EC 4.2.1.33 (characterized)
to candidate CA265_RS15830 CA265_RS15830 3-isopropylmalate dehydratase large subunit

Query= CharProtDB::CH_024771
         (466 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS15830 CA265_RS15830
           3-isopropylmalate dehydratase large subunit
          Length = 470

 Score =  544 bits (1401), Expect = e-159
 Identities = 273/466 (58%), Positives = 340/466 (72%), Gaps = 3/466 (0%)

Query: 1   MAKTLYEKLFDAHVVYEAENETPLLYIDRHLVHEVTSPQAFDGLRAHGRPVRQPGKTFAT 60
           M+KTL EK++DAHVV   E    +LYID HL+HEVTSPQAFDGLR  G PV +P +T AT
Sbjct: 1   MSKTLVEKIWDAHVVKSEEGFPDILYIDTHLIHEVTSPQAFDGLRKRGLPVFRPKQTVAT 60

Query: 61  MDHNVSTQTKDINACGEMARIQMQELIKNCKEFGVELYDLNHPYQGIVHVMGPEQGVTLP 120
            DHNV T  + +    E++R Q+  L KNC EFGVELY L HP+QGIVHV+GPE G+TLP
Sbjct: 61  ADHNVPTLNQLLPIKEELSRYQVDMLTKNCAEFGVELYGLGHPFQGIVHVIGPELGITLP 120

Query: 121 GMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQGRAKTMKIEVQGKAAPGITA 180
           G T+VCGDSHT+THGAFGA+AFGIGTS+VE V ATQ L Q + KTMKIEV G+   G+ A
Sbjct: 121 GKTMVCGDSHTSTHGAFGAIAFGIGTSQVEQVFATQCLLQSKPKTMKIEVNGELGKGVGA 180

Query: 181 KDIVLAIIGKTGSAGGTGHVVEFCGEAIRDLSMEGRMTLCNMAIEMGAKAGLVAPDETTF 240
           KDI+L II K  +AGGTG+ +E+ G AI  LSME RMT+CNM+IEMGA+ GL+APD+TTF
Sbjct: 181 KDIILYIIAKISAAGGTGYFIEYAGSAIEALSMEARMTICNMSIEMGARGGLIAPDQTTF 240

Query: 241 NYVKGRLHAPKGKDFDDAVAYWKTLQTDEGATFDTVVTLQAEEISPQVTWGTNPGQVISV 300
           +Y+KGR  AP G+++D A+AYWKTL +D  A FD+V+T  A +I+P +T+GTNPG  + +
Sbjct: 241 DYIKGREFAPAGEEWDKALAYWKTLYSDADAKFDSVLTFDAADIAPMITYGTNPGMGMGI 300

Query: 301 NDNIPDPASFADP-VERASAEKALAYMGLKPGIPLTEVAIDKVFIGSCTNSRIEDLRAAA 359
            ++I  PA+ A P  E+ S +KAL YMG      L    +D VFIGSCTNSRIEDLR  A
Sbjct: 301 QEHI--PATGAQPEKEKLSYQKALDYMGFDDDSSLIGKPVDYVFIGSCTNSRIEDLREVA 358

Query: 360 EIAKGRKVAPGVQALVVPGSGPVKAQAEAEGLDKIFIEAGFEWRLPGCSMCLAMNNDRLN 419
           +  K ++ A  V   +VPGS  V+ QA+ EGLDKIF  AGF+ R PGCS CL MN D++ 
Sbjct: 359 DFVKDKRKADNVTVWIVPGSKQVEQQAKNEGLDKIFEAAGFQLREPGCSACLGMNEDKIP 418

Query: 420 PGERCASTSNRNFEGRQGRGGRTHLVSPAMAAAAAVTGHFADIRNI 465
            G+ C STSNRNFEGRQG+  RT L SP  AAAAAVTG   D+R++
Sbjct: 419 AGKYCVSTSNRNFEGRQGQNARTLLASPLTAAAAAVTGKITDVRDL 464


Lambda     K      H
   0.317    0.134    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 670
Number of extensions: 28
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 466
Length of database: 470
Length adjustment: 33
Effective length of query: 433
Effective length of database: 437
Effective search space:   189221
Effective search space used:   189221
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

Align candidate CA265_RS15830 CA265_RS15830 (3-isopropylmalate dehydratase large subunit)
to HMM TIGR00170 (leuC: 3-isopropylmalate dehydratase, large subunit (EC 4.2.1.33))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00170.hmm
# target sequence database:        /tmp/gapView.22509.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00170  [M=466]
Accession:   TIGR00170
Description: leuC: 3-isopropylmalate dehydratase, large subunit
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   1.1e-216  705.8   0.0   1.3e-216  705.6   0.0    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS15830  CA265_RS15830 3-isopropylmalate 


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS15830  CA265_RS15830 3-isopropylmalate dehydratase large subunit
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  705.6   0.0  1.3e-216  1.3e-216       1     466 []       1     464 [.       1     464 [. 0.99

  Alignments for each domain:
  == domain 1  score: 705.6 bits;  conditional E-value: 1.3e-216
                                  TIGR00170   1 maktlyeklfdahvvkeaenetdllyidrhlvhevtspqafeglraagrkvrrvdktlatldhniste 68 
                                                m+ktl+ek++dahvvk +e+ +d+lyid hl+hevtspqaf+glr++g +v r+++t+at dhn++t 
  lcl|FitnessBrowser__Pedo557:CA265_RS15830   1 MSKTLVEKIWDAHVVKSEEGFPDILYIDTHLIHEVTSPQAFDGLRKRGLPVFRPKQTVATADHNVPTL 68 
                                                79****************************************************************** PP

                                  TIGR00170  69 srdveikeekaklqvkeleknvkefgvklfdlssaeqgivhvvgpeegltlpgktivcgdshtathga 136
                                                ++ + ikee ++ qv  l+kn+ efgv+l++l +  qgivhv+gpe g+tlpgkt+vcgdsht+thga
  lcl|FitnessBrowser__Pedo557:CA265_RS15830  69 NQLLPIKEELSRYQVDMLTKNCAEFGVELYGLGHPFQGIVHVIGPELGITLPGKTMVCGDSHTSTHGA 136
                                                ******************************************************************** PP

                                  TIGR00170 137 fgalafgigtsevehvlatqtlkqaraktlkievegklakgitakdiilaiigkigvaggtgyvvefa 204
                                                fga+afgigts+ve v+atq l q+++kt+kiev+g+l kg+ akdiil+ii ki++aggtgy +e+a
  lcl|FitnessBrowser__Pedo557:CA265_RS15830 137 FGAIAFGIGTSQVEQVFATQCLLQSKPKTMKIEVNGELGKGVGAKDIILYIIAKISAAGGTGYFIEYA 204
                                                ******************************************************************** PP

                                  TIGR00170 205 geairdlsmeermtvcnmaieagakagliapdettfeyvkdrkyapkgkefekavaywktlktdegak 272
                                                g ai++lsme+rmt+cnm+ie+ga+ gliapd+ttf+y+k+r++ap g+e++ka+aywktl +d +ak
  lcl|FitnessBrowser__Pedo557:CA265_RS15830 205 GSAIEALSMEARMTICNMSIEMGARGGLIAPDQTTFDYIKGREFAPAGEEWDKALAYWKTLYSDADAK 272
                                                ******************************************************************** PP

                                  TIGR00170 273 fdkvvtleakdispqvtwgtnpgqvlsvneevpdpksladpvekasaekalaylglepgtklkdikvd 340
                                                fd v+t++a di+p++t+gtnpg+ + ++e++p+      + ek s +kal+y+g++ + +l    vd
  lcl|FitnessBrowser__Pedo557:CA265_RS15830 273 FDSVLTFDAADIAPMITYGTNPGMGMGIQEHIPATGA-QPEKEKLSYQKALDYMGFDDDSSLIGKPVD 339
                                                *********************************9765.5677899*********************** PP

                                  TIGR00170 341 kvfigsctnsriedlraaaevvkgkkvadnvklalvvpgsglvkkqaekegldkifleagfewreagc 408
                                                 vfigsctnsriedlr+ a+ vk k++adnv  + +vpgs++v +qa++egldkif +agf+ re+gc
  lcl|FitnessBrowser__Pedo557:CA265_RS15830 340 YVFIGSCTNSRIEDLREVADFVKDKRKADNVT-VWIVPGSKQVEQQAKNEGLDKIFEAAGFQLREPGC 406
                                                *******************************9.99********************************* PP

                                  TIGR00170 409 slclgmnndvldeyercastsnrnfegrqgkgarthlvspamaaaaavagkfvdirel 466
                                                s clgmn+d++++++ c stsnrnfegrqg++art l sp  aaaaav+gk+ d+r+l
  lcl|FitnessBrowser__Pedo557:CA265_RS15830 407 SACLGMNEDKIPAGKYCVSTSNRNFEGRQGQNARTLLASPLTAAAAAVTGKITDVRDL 464
                                                ********************************************************85 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (466 nodes)
Target sequences:                          1  (470 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.02u 0.01s 00:00:00.03 Elapsed: 00:00:00.02
# Mc/sec: 8.47
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory