GapMind for Amino acid biosynthesis

 

Aligments for a candidate for dapF in Pedobacter sp. GW460-11-11-14-LB5

Align Diaminopimelate epimerase; DAP epimerase; EC 5.1.1.7; PLP-independent amino acid racemase (uncharacterized)
to candidate CA265_RS23025 CA265_RS23025 diaminopimelate epimerase

Query= curated2:A6GYX5
         (256 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS23025 CA265_RS23025
           diaminopimelate epimerase
          Length = 260

 Score =  245 bits (625), Expect = 8e-70
 Identities = 122/255 (47%), Positives = 167/255 (65%), Gaps = 3/255 (1%)

Query: 1   MKLYKYQGTGNDFIMIDNRLQIFPKQNTALIQKLCDRRFGIGADGLILLENDQSTDFKMV 60
           +  +KYQG GNDFI+ID+ +      +  L+++LC RRFGIGADGL+ +   +  DF+M 
Sbjct: 3   INFFKYQGAGNDFILIDHTMSPLKNIDNQLVEQLCHRRFGIGADGLMFITKHEDYDFEMH 62

Query: 61  YYNSDGNQSTMCGNGGRCLVAFAKKLNIIKNKTTFIAIDGLHHATINEN-DIISLQMKNV 119
           Y+N+DG   +MCGNGGRC+VAFAK+L II  +T F+A+DG H+A I+EN + + LQM +V
Sbjct: 63  YFNADGKLGSMCGNGGRCIVAFAKQLGIIDRETNFLAVDGPHYARISENGEWVDLQMIDV 122

Query: 120 EEVNIHDNYVFLNTGSPHHVQFADNLSNFDVKNEGAKIRYSDLYGQAGSNINFVHQTSPT 179
           + +        LNTGSPH+V    +L +FDV   G  IRY+  Y + G N+NFV      
Sbjct: 123 DTITKDGEAYILNTGSPHYVALQSDLKDFDVFTAGKNIRYNATYAEKGINVNFVEDKGDH 182

Query: 180 QFSIRTYERGVEDETLSCGTGATATAIAM-KATGKTNSNNITINVQGGKLEVSFNQENSI 238
            F +RTYERGVEDET +CGTG TA A+AM K   +T      I V GG +++ F+ +   
Sbjct: 183 LF-VRTYERGVEDETYACGTGVTAVAMAMAKHKNQTGHIKTAIKVLGGDIKIEFDYDGKE 241

Query: 239 FTNIFLKGPAEFVFE 253
           FTN+FL GPA+ VFE
Sbjct: 242 FTNVFLCGPAKLVFE 256


Lambda     K      H
   0.318    0.135    0.386 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 251
Number of extensions: 9
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 256
Length of database: 260
Length adjustment: 24
Effective length of query: 232
Effective length of database: 236
Effective search space:    54752
Effective search space used:    54752
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.7 bits)

Align candidate CA265_RS23025 CA265_RS23025 (diaminopimelate epimerase)
to HMM TIGR00652 (dapF: diaminopimelate epimerase (EC 5.1.1.7))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR00652.hmm
# target sequence database:        /tmp/gapView.5443.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00652  [M=270]
Accession:   TIGR00652
Description: DapF: diaminopimelate epimerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
    1.1e-66  211.0   1.8    2.2e-65  206.7   1.8    1.9  1  lcl|FitnessBrowser__Pedo557:CA265_RS23025  CA265_RS23025 diaminopimelate ep


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS23025  CA265_RS23025 diaminopimelate epimerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  206.7   1.8   2.2e-65   2.2e-65       1     268 [.       3     259 ..       3     260 .] 0.90

  Alignments for each domain:
  == domain 1  score: 206.7 bits;  conditional E-value: 2.2e-65
                                  TIGR00652   1 meFlkmhGlgNdFvlvdevdeelvkeeaelvrkvcdrhtgvgaDgvllvepsseeadvklrifNsDGS 68 
                                                ++F+k++G+gNdF+l+d+  + l + +++lv+++c+r++g+gaDg++++++ +e++d+++++fN+DG 
  lcl|FitnessBrowser__Pedo557:CA265_RS23025   3 INFFKYQGAGNDFILIDHTMSPLKNIDNQLVEQLCHRRFGIGADGLMFITK-HEDYDFEMHYFNADGK 69 
                                                68*****************988888889**********************6.**************** PP

                                  TIGR00652  69 eaemCGNgiRcfakfvyekglkekkelsvetlaglikveveeenkkvkvdmgepkfkkeeipltveke 136
                                                  +mCGNg Rc+++f+++ g+ + +e ++ +  g   + + e++++v  +m  ++       +t++  
  lcl|FitnessBrowser__Pedo557:CA265_RS23025  70 LGSMCGNGGRCIVAFAKQLGIID-RETNFLAVDGPHYARISENGEWVDLQMIDVDT------ITKD-- 128
                                                **********************6.999*****************999999988732......2221.. PP

                                  TIGR00652 137 eekeellalevlvvdvGnPHlvvfvedvekldleelgklleaheef.pegvNvefvevkkedeiklrv 203
                                                         e +++++G PH v   +d++++d+ + gk ++++ ++  +g+Nv+fve k+ d++++r+
  lcl|FitnessBrowser__Pedo557:CA265_RS23025 129 G--------EAYILNTGSPHYVALQSDLKDFDVFTAGKNIRYNATYaEKGINVNFVEDKG-DHLFVRT 187
                                                1........124589*******************************899**********9.9****** PP

                                  TIGR00652 204 yERG.ageTlaCGtGavAsavvalklgktkkk..vtvhleggeLeievkedg....kvyltGpavlvl 264
                                                yERG ++eT aCGtG +A+a++ +k +++  +   ++++ gg+++ie+  dg    +v+l Gpa+lv+
  lcl|FitnessBrowser__Pedo557:CA265_RS23025 188 YERGvEDETYACGTGVTAVAMAMAKHKNQTGHikTAIKVLGGDIKIEFDYDGkeftNVFLCGPAKLVF 255
                                                ****************9999887775554443238999**********988877889*********** PP

                                  TIGR00652 265 egel 268
                                                ege+
  lcl|FitnessBrowser__Pedo557:CA265_RS23025 256 EGEV 259
                                                *986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (270 nodes)
Target sequences:                          1  (260 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.04u 0.01s 00:00:00.05 Elapsed: 00:00:00.03
# Mc/sec: 2.03
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory