Align N-acetyldiaminopimelate deacetylase; EC 3.5.1.47 (characterized)
to candidate CA265_RS17965 CA265_RS17965 N-acyl-L-amino acid amidohydrolase
Query= SwissProt::D5E0A1 (375 letters) >FitnessBrowser__Pedo557:CA265_RS17965 Length = 434 Score = 206 bits (524), Expect = 1e-57 Identities = 130/358 (36%), Positives = 193/358 (53%), Gaps = 24/358 (6%) Query: 3 ENEFVKIRRELHKIPELGFQEVKTQRFLLDYINTLPQERLEVKTW--KTGLFVKVHGTNP 60 E + + RR+ H+ PELG EV+T + ++ +L ++VKT KTG+ + G P Sbjct: 35 EQKVIAWRRDFHEHPELGNTEVRTAGIIAKHLESLG---IQVKTGVAKTGVVGVLKGGKP 91 Query: 61 TKTIGYRADIDGLPITEETNYSFQS--------QHEGLMHACGHDMHMAIGLGVLTYFA- 111 + RAD+DGLP+TE + F S Q G+MHACGHD H+AI +GV A Sbjct: 92 GPVVALRADMDGLPVTERVDVPFASKVKTQYNGQEVGVMHACGHDSHVAILMGVAEVLAS 151 Query: 112 -QHEIKDNVLFIFQPAEEG-----PGGAQPMLQSDIMKEWLPDFIFALHVAPEYPVGSIA 165 Q +I+ V FIFQPAEEG GGA M++ +++ D IF LH+ + VG + Sbjct: 152 MQKDIQGTVKFIFQPAEEGVPAGDEGGAALMIKEGVLENPKVDVIFGLHINSQTEVGDVT 211 Query: 166 LKEGLLFANTSELFIDLKGKGGHAAYPHTTNDMVVAACQLVSQLQTIVARNVDPLDS-AV 224 + G A +++ I + G+ H AYP + D VV + Q+++ LQTIV+RN++ ++ V Sbjct: 212 YRPGGTMAAVNDMKITVTGRQAHGAYPWNSIDPVVVSAQIINSLQTIVSRNLNVTENPGV 271 Query: 225 ITVGKIQGGTVQNIIAERARIEGTIRTLSPESMTRVKERIEAIV-KGVEV-GYQCETAID 282 +T+G I GG NII E+ + GT+R S E ERI+ IV K E G E I Sbjct: 272 VTIGAINGGVRSNIIPEKVEMLGTVRNFSKEDEAMFIERIKTIVTKTAEAGGATAEVKIP 331 Query: 283 YGCMYHQVYNHHEVTREFMEFAKEQTDVDVIECKEAMTG-EDFGYMLKDIPGFMFWLG 339 Y Y +NH +T + + + D ++ K +TG EDF + + IPG +LG Sbjct: 332 YSNHYPVTFNHIALTEKMLPSMQNTAGKDHVKLKPPVTGAEDFSFFQEKIPGLFVFLG 389 Lambda K H 0.320 0.137 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 442 Number of extensions: 22 Number of successful extensions: 8 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 375 Length of database: 434 Length adjustment: 31 Effective length of query: 344 Effective length of database: 403 Effective search space: 138632 Effective search space used: 138632 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory