GapMind for Amino acid biosynthesis

 

Aligments for a candidate for proB in Pedobacter sp. GW460-11-11-14-LB5

Align Glutamate 5-kinase; EC 2.7.2.11; Gamma-glutamyl kinase; GK (uncharacterized)
to candidate CA265_RS20855 CA265_RS20855 glutamate 5-kinase

Query= curated2:Q8A1E7
         (360 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS20855 CA265_RS20855 glutamate
           5-kinase
          Length = 359

 Score =  369 bits (946), Expect = e-107
 Identities = 194/359 (54%), Positives = 257/359 (71%), Gaps = 4/359 (1%)

Query: 1   MKQEFTRIAVKVGSNVLARRDGTLDVTRMSALVDQIAELNKSGVEIILISSGAVASGRSE 60
           MK  + +I VKVGSNV+ + +G  D  R+  LV+Q+A++ K G+E+IL+SSGAVASGRS 
Sbjct: 1   MKLGYKKIVVKVGSNVITQANGLPDEGRIKHLVNQLADIKKQGIEVILVSSGAVASGRSL 60

Query: 61  IHPQKKLDSVDQRQLFSAVGQAKLINRYYELFREHGIAVGQVLTTKENFSTRRHYLNQKN 120
           I   +K D+V  RQL +A+GQ KLIN Y   F  H I   QVL TKE+F  R HYLN KN
Sbjct: 61  IKVSEKQDAVTTRQLLAAIGQVKLINTYANFFAAHAIQCAQVLVTKEDFRDRAHYLNMKN 120

Query: 121 CMTVMLENGVIPIVNENDTISVSELMFTDNDELSGLIASMMDAQALIILSNIDGIYNGSP 180
           C+ ++L+N VIP+VNEND +SV+ELMFTDNDEL+GLIASM++A ALIILSN++GIYNG P
Sbjct: 121 CLQILLQNEVIPVVNENDVVSVTELMFTDNDELAGLIASMLNADALIILSNVNGIYNGDP 180

Query: 181 SDPASAVIREIEHG-KDLSNYIQATKSSFGRGGMLTKTNIARKVADEGITVIIANGKRDN 239
               SAVI EI     +L+++IQ  KS FGRGGM+TK+ +A+KVA  GITV IANG +DN
Sbjct: 181 KVEGSAVIEEINGSVANLASFIQTGKSQFGRGGMITKSTMAQKVAKLGITVHIANGTKDN 240

Query: 240 ILVDLLQQPDDTVCTRFIPSTEAVSSVKKWIAHSEGFAKGEIHINECATDILSSEKAASI 299
           +L  LL   ++ V TRF+P  ++ S  KKWIAHSE  A G + +N+ A  +L+S KA S+
Sbjct: 241 VLTSLLN--NELVHTRFVPE-KSKSGKKKWIAHSETAATGVVKLNDGAKTVLTSSKATSL 297

Query: 300 LPVGITHIEGEFEKDDIVRIMDFLGNQVGVGKANCDSAQAREAMGKHGKKPVVHYDYLY 358
           LPVGI  I+ +F K DI++I+D   N +G+G A   S +ARE +G+  +K +VHYDY Y
Sbjct: 298 LPVGIIEIQTDFLKGDIIKIVDEKNNLIGLGIAEYGSDKARERIGQKKQKALVHYDYFY 356


Lambda     K      H
   0.316    0.133    0.369 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 355
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 360
Length of database: 359
Length adjustment: 29
Effective length of query: 331
Effective length of database: 330
Effective search space:   109230
Effective search space used:   109230
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate CA265_RS20855 CA265_RS20855 (glutamate 5-kinase)
to HMM TIGR01027 (proB: glutamate 5-kinase (EC 2.7.2.11))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01027.hmm
# target sequence database:        /tmp/gapView.2506.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01027  [M=363]
Accession:   TIGR01027
Description: proB: glutamate 5-kinase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
    6.1e-97  310.9  12.6    6.8e-97  310.8  12.6    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS20855  CA265_RS20855 glutamate 5-kinase


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS20855  CA265_RS20855 glutamate 5-kinase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  310.8  12.6   6.8e-97   6.8e-97       1     344 [.       6     349 ..       6     359 .] 0.94

  Alignments for each domain:
  == domain 1  score: 310.8 bits;  conditional E-value: 6.8e-97
                                  TIGR01027   1 kriVvKlGsssLteesgklkrsklaelveqvaklkkaGhevvivsSGavaaGleaLglperpkklaek 68 
                                                k+iVvK+Gs+++t+ +g +++ ++++lv+q+a +kk+G ev++vsSGava+G + + ++e++  ++++
  lcl|FitnessBrowser__Pedo557:CA265_RS20855   6 KKIVVKVGSNVITQANGLPDEGRIKHLVNQLADIKKQGIEVILVSSGAVASGRSLIKVSEKQDAVTTR 73 
                                                68****************************************************************** PP

                                  TIGR01027  69 QalaaVGQgrLmklyeklfsqyglkvaQiLLtradlskrerylNarntleellelgvvpivNENDtva 136
                                                Q+laa+GQ++L+++y + f+ + ++ aQ+L t++d+++r +ylN +n l+ ll+++v+p+vNEND v+
  lcl|FitnessBrowser__Pedo557:CA265_RS20855  74 QLLAAIGQVKLINTYANFFAAHAIQCAQVLVTKEDFRDRAHYLNMKNCLQILLQNEVIPVVNENDVVS 141
                                                ******************************************************************** PP

                                  TIGR01027 137 veeikfGDNDtLsalvaalveAdlLvlltdvdgLydadprtnpdAklieeveeieeelkavagssgss 204
                                                v+e+ f DND+L+ l+a++++Ad+L++l++v+g+y+ dp+ +  A +iee++   ++l ++  ++ s+
  lcl|FitnessBrowser__Pedo557:CA265_RS20855 142 VTELMFTDNDELAGLIASMLNADALIILSNVNGIYNGDPKVEGSA-VIEEINGSVANLASFIQTGKSQ 208
                                                ***************************************888776.7899998888888777777789 PP

                                  TIGR01027 205 vGTGGmrtKleaaelAsragveviiasgekpekiadlledaavgtlfeakkkklknrkqwilaas.ea 271
                                                +G GGm tK + a+  +++g+ v ia+g+k + +++ll+++ v+t f ++k+  + +k+wi++ + +a
  lcl|FitnessBrowser__Pedo557:CA265_RS20855 209 FGRGGMITKSTMAQKVAKLGITVHIANGTKDNVLTSLLNNELVHTRFVPEKS-KSGKKKWIAHSEtAA 275
                                                *************************************************988.577889999976157 PP

                                  TIGR01027 272 kGkiivdegaeealle.kgksLlpagvvevegnFsrgevveilaeegqeigkglvnysseelekikgl 338
                                                +G + +++ga++ l++ k +sLlp+g++e++ +F +g++++i++e+ + ig g ++y s++ ++  g+
  lcl|FitnessBrowser__Pedo557:CA265_RS20855 276 TGVVKLNDGAKTVLTSsKATSLLPVGIIEIQTDFLKGDIIKIVDEKNNLIGLGIAEYGSDKARERIGQ 343
                                                8************98725678******************************************99999 PP

                                  TIGR01027 339 kseeie 344
                                                k+++  
  lcl|FitnessBrowser__Pedo557:CA265_RS20855 344 KKQKAL 349
                                                987654 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (363 nodes)
Target sequences:                          1  (359 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01
# Mc/sec: 7.48
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory