GapMind for Amino acid biosynthesis

 

Aligments for a candidate for serC in Pedobacter sp. GW460-11-11-14-LB5

Align phosphoserine transaminase (EC 2.6.1.52) (characterized)
to candidate CA265_RS09005 CA265_RS09005 phosphoserine transaminase

Query= BRENDA::Q59196
         (362 letters)



>lcl|FitnessBrowser__Pedo557:CA265_RS09005 CA265_RS09005
           phosphoserine transaminase
          Length = 357

 Score =  338 bits (868), Expect = 1e-97
 Identities = 168/356 (47%), Positives = 253/356 (71%), Gaps = 5/356 (1%)

Query: 6   YNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEAVHNEAQARLLALLGNP 65
           +NF AGP  LP EV ++A    +D+ + G+SI+E+SHR   +EAV  EA   +  LL  P
Sbjct: 3   HNFGAGPCILPQEVFKQAAQAVLDF-NDGLSILEISHRTTEFEAVVAEADKLVKELLNVP 61

Query: 66  TGYKVLFIQGGASTQFAMIPMNFLKEGQTANYVMTGSWASKALKEAKLIGDTHVAASSEA 125
           +GY VLF+QGGAS QFAM+PMN L +GQTA+Y+ +G WA+KALKEAK IG+ +V ASS+ 
Sbjct: 62  SGYSVLFLQGGASLQFAMVPMNLLGDGQTASYLDSGVWATKALKEAKFIGNVNVVASSKD 121

Query: 126 SNYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFKAFPDTGSVPLIGDMSSDILSRPFDL 185
           +NY  +PK  + ++  ++AY H TSN TI G +    P T +VP++ DMSSDI+SR  D+
Sbjct: 122 ANYTFIPK--DFEIPADSAYFHYTSNNTIYGTELFEVPKT-NVPVVCDMSSDIMSRVIDV 178

Query: 186 NQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHLPTMLRYDTYVKNNSLYNTPPSFGI 245
           ++F L+YAGAQKN+GP+G+T+ IV+ +++ +  + +P+ML Y +++ N+S+YNTPP F I
Sbjct: 179 SKFDLIYAGAQKNVGPAGLTIAIVKNEVLGKIDRKIPSMLNYQSHIDNDSMYNTPPVFSI 238

Query: 246 YMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCVDVDSRSDMNITFRLA 305
           Y+    L+W++ +GG+  +++ N++KA  +Y  ID++   ++G   V+ RS MN+ F + 
Sbjct: 239 YVALLNLRWLKSKGGVAEIEKENKQKAEALYREIDRN-PLFKGTCAVEDRSRMNVCFVME 297

Query: 306 SEELEKEFVKASEQEGFVGLKGHRSVGGLRASIYNAVPYESCEALVQFMEHFKRSR 361
           + ELEK F+K +E++G VG+KGHRSVGG RAS+YNA+P  S  ALV  M+ F+  +
Sbjct: 298 NPELEKPFLKYAEEQGIVGIKGHRSVGGFRASMYNALPITSVHALVDAMQVFEEQQ 353


Lambda     K      H
   0.316    0.132    0.378 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 355
Number of extensions: 15
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 362
Length of database: 357
Length adjustment: 29
Effective length of query: 333
Effective length of database: 328
Effective search space:   109224
Effective search space used:   109224
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 49 (23.5 bits)

Align candidate CA265_RS09005 CA265_RS09005 (phosphoserine transaminase)
to HMM TIGR01364 (serC: phosphoserine transaminase (EC 2.6.1.52))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.aa/TIGR01364.hmm
# target sequence database:        /tmp/gapView.9614.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR01364  [M=358]
Accession:   TIGR01364
Description: serC_1: phosphoserine transaminase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                                  Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                                  -----------
   1.6e-149  483.6   0.1   1.8e-149  483.4   0.1    1.0  1  lcl|FitnessBrowser__Pedo557:CA265_RS09005  CA265_RS09005 phosphoserine tran


Domain annotation for each sequence (and alignments):
>> lcl|FitnessBrowser__Pedo557:CA265_RS09005  CA265_RS09005 phosphoserine transaminase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  483.4   0.1  1.8e-149  1.8e-149       2     357 ..       3     352 ..       2     353 .. 0.99

  Alignments for each domain:
  == domain 1  score: 483.4 bits;  conditional E-value: 1.8e-149
                                  TIGR01364   2 vnFsaGPaalpeevlekaqkelldfnglglsvmeisHRskefekvveeaesdlreLlnipdnyevlfl 69 
                                                +nF+aGP++lp+ev+++a++ +ldfn+ gls++eisHR+ efe+vv ea++ ++eLln+p+ y+vlfl
  lcl|FitnessBrowser__Pedo557:CA265_RS09005   3 HNFGAGPCILPQEVFKQAAQAVLDFND-GLSILEISHRTTEFEAVVAEADKLVKELLNVPSGYSVLFL 69 
                                                8************************86.9*************************************** PP

                                  TIGR01364  70 qGGattqfaavplnllkekkvadyivtGawskkalkeakkltkevkvvaseeekkyskipdeeelelk 137
                                                qGGa+ qfa+vp+nll ++++a+y+ +G+w++kalkeak +++ v+vvas+++ +y+ ip  +++e+ 
  lcl|FitnessBrowser__Pedo557:CA265_RS09005  70 QGGASLQFAMVPMNLLGDGQTASYLDSGVWATKALKEAKFIGN-VNVVASSKDANYTFIP--KDFEIP 134
                                                *****************************************99.****************..89**** PP

                                  TIGR01364 138 edaayvylcanetieGvefkelpevkkaplvaDlssdilsrkidvskygliyaGaqKniGpaGvtvvi 205
                                                 d+ay+++++n+ti+G+e  e+p ++++p+v+D+ssdi+sr idvsk++liyaGaqKn+GpaG+t+ i
  lcl|FitnessBrowser__Pedo557:CA265_RS09005 135 ADSAYFHYTSNNTIYGTELFEVP-KTNVPVVCDMSSDIMSRVIDVSKFDLIYAGAQKNVGPAGLTIAI 201
                                                ***********************.789***************************************** PP

                                  TIGR01364 206 vrkdllerakkelpsvldYkilaendslyntpptfaiyvlglvlkwlkekGGvkklekknqeKakllY 273
                                                v++++l+++ +++ps+l+Y+++++nds+yntpp+f+iyv+ l l+wlk+kGGv+++ek+n++Ka+ lY
  lcl|FitnessBrowser__Pedo557:CA265_RS09005 202 VKNEVLGKIDRKIPSMLNYQSHIDNDSMYNTPPVFSIYVALLNLRWLKSKGGVAEIEKENKQKAEALY 269
                                                ******************************************************************** PP

                                  TIGR01364 274 eaidesegfyknkvekkaRslmnvvFtlkkeelekeFlkeaeekglvslkGhrsvGGiRasiYnalpl 341
                                                  id++  ++k++ + ++Rs+mnv+F +++ elek Flk aee+g+v++kGhrsvGG+Ras+Ynalp+
  lcl|FitnessBrowser__Pedo557:CA265_RS09005 270 REIDRNP-LFKGTCAVEDRSRMNVCFVMENPELEKPFLKYAEEQGIVGIKGHRSVGGFRASMYNALPI 336
                                                ****886.************************************************************ PP

                                  TIGR01364 342 eevqaLvdfmkeFekk 357
                                                 +v+aLvd m+ Fe++
  lcl|FitnessBrowser__Pedo557:CA265_RS09005 337 TSVHALVDAMQVFEEQ 352
                                                *************986 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (358 nodes)
Target sequences:                          1  (357 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01
# Mc/sec: 10.49
//
[ok]

This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code, or see changes to Amino acid biosynthesis since the publication.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory