Align tryptophan synthase (EC 4.2.1.20) (characterized)
to candidate CA265_RS05020 CA265_RS05020 tryptophan synthase subunit beta
Query= BRENDA::Q97TX6 (429 letters) >FitnessBrowser__Pedo557:CA265_RS05020 Length = 393 Score = 138 bits (347), Expect = 3e-37 Identities = 130/400 (32%), Positives = 190/400 (47%), Gaps = 51/400 (12%) Query: 43 LKEVLPSKVLELEFAKERYVKIPDE---------VLERYLQVGRPTPIIRAKRLEEYLGN 93 + E+L V EL ++ Y+KI D+ +L+ Y VGRP+P+ AKR E G Sbjct: 19 IPEMLYPNVEEL---RQNYLKIIDDADFQKEFHQLLKDY--VGRPSPLYLAKRYSERYGA 73 Query: 94 NIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETGAGQWGSSVALASALFRMK 153 NI +LK E +TG+HKIN+ + + A+ K + ETGAGQ G + A AL ++ Sbjct: 74 NI--FLKREDLNHTGAHKINNTIGQILLAEKLGKKRIIAETGAGQHGVATATVCALRNLE 131 Query: 154 AHIFMVRTSYYAKPYRKYMMQMYGAEVHPSPSDLTEFGRQLLAKDSNHPGSLGIAISDAV 213 I+M + M+M GA+V P+ S G + L +N A+ D + Sbjct: 132 CVIYMGEVDIERQAPNVARMKMLGAKVVPASS-----GSKTLKDATNE------AMRDWI 180 Query: 214 EYAHKNGGKYVVGSVVNSD------IMFKTIAGMEAKKQ-MELIGED-PDYIIGVVGGGS 265 + Y++GSVV +F++I E KKQ +E G D PDY++ VGGGS Sbjct: 181 N--NPVDTHYIIGSVVGPHPYPDMVAIFQSIISEETKKQLLEQTGSDQPDYVLACVGGGS 238 Query: 266 NYAALAYPFLGDE---LRSGKVRRKYIASGSSEVPKMTKGVYKYDYPDTAKLLPMLKMYT 322 N + Y F+ DE L + + K ++SG S T + K ++ + M T Sbjct: 239 NAMGMFYHFMDDENVKLIAVEAAGKGVSSGFSAA---TTYLGKEGVLHGSR---SILMQT 292 Query: 323 IGSDFVPPPVYAGGLRYHGVAPTLSLLISKGIVQARDYSQEESFKWAKLFSELEGYIPAP 382 V P + GL Y G+ P + L G Q + EES L ++LEG IPA Sbjct: 293 EDGQVVEPHSVSAGLDYPGIGPQHAHLFKTGRGQYVSITDEESLDAGLLCTQLEGIIPAI 352 Query: 383 ETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLGNY 422 E++HAL L ++ K GE V+V SG G DL Y Sbjct: 353 ESAHALAYLEKM---EFKGGE--NVVVCLSGRGDKDLDTY 387 Lambda K H 0.316 0.135 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 449 Number of extensions: 25 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 429 Length of database: 393 Length adjustment: 31 Effective length of query: 398 Effective length of database: 362 Effective search space: 144076 Effective search space used: 144076 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate CA265_RS05020 CA265_RS05020 (tryptophan synthase subunit beta)
to HMM TIGR00263 (trpB: tryptophan synthase, beta subunit (EC 4.2.1.20))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR00263.hmm # target sequence database: /tmp/gapView.1046.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR00263 [M=385] Accession: TIGR00263 Description: trpB: tryptophan synthase, beta subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.6e-181 587.4 0.1 7.5e-181 587.2 0.1 1.0 1 lcl|FitnessBrowser__Pedo557:CA265_RS05020 CA265_RS05020 tryptophan synthas Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Pedo557:CA265_RS05020 CA265_RS05020 tryptophan synthase subunit beta # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 587.2 0.1 7.5e-181 7.5e-181 1 383 [. 9 389 .. 9 391 .. 0.98 Alignments for each domain: == domain 1 score: 587.2 bits; conditional E-value: 7.5e-181 TIGR00263 1 gkfgefGGqyvpevllealeelekayekakkdeefkkeleellkeyagrptpltfaknlskklggaki 68 g++g+fGG+y+pe+l +++eel+++y k+ +d +f+ke+++llk+y+grp+pl+ ak++s+++g a+i lcl|FitnessBrowser__Pedo557:CA265_RS05020 9 GYYGDFGGAYIPEMLYPNVEELRQNYLKIIDDADFQKEFHQLLKDYVGRPSPLYLAKRYSERYG-ANI 75 79*************************************************************8.*** PP TIGR00263 69 ylkredllhtGahkinnalgqallakrlGkkriiaetGaGqhGvatataaallglecevymGaedver 136 +lkredl+htGahkinn++gq+lla++lGkkriiaetGaGqhGvatat++al +lec++ymG+ d+er lcl|FitnessBrowser__Pedo557:CA265_RS05020 76 FLKREDLNHTGAHKINNTIGQILLAEKLGKKRIIAETGAGQHGVATATVCALRNLECVIYMGEVDIER 143 ******************************************************************** PP TIGR00263 137 qklnvfrmellgakvvpvtsGsktlkdavnealrdWvtsvedthyvlGsavGphPfPeivrefqsvig 204 q++nv rm++lgakvvp +sGsktlkda+nea+rdW+ + dthy++Gs+vGphP+P++v fqs+i+ lcl|FitnessBrowser__Pedo557:CA265_RS05020 144 QAPNVARMKMLGAKVVPASSGSKTLKDATNEAMRDWINNPVDTHYIIGSVVGPHPYPDMVAIFQSIIS 211 ******************************************************************** PP TIGR00263 205 eevkeqileke.grlPdaviacvGGGsnaiGifaafiedeeveligveagGkGidtekhaatlskGke 271 ee+k+q+le+ Pd+v+acvGGGsna+G+f++f++de+v+li+vea+GkG+++ aat Gke lcl|FitnessBrowser__Pedo557:CA265_RS05020 212 EETKKQLLEQTgSDQPDYVLACVGGGSNAMGMFYHFMDDENVKLIAVEAAGKGVSSGFSAATTYLGKE 279 *********996789***************************************************** PP TIGR00263 272 GvlhGaktkllqdedGqieeahsvsaGldypgvgPehaalaetgraeyeaitdeealealkllskeeG 339 GvlhG+++ l+q+edGq+ e hsvsaGldypg+gP+ha+l +tgr +y++itdee+l+a l+++ eG lcl|FitnessBrowser__Pedo557:CA265_RS05020 280 GVLHGSRSILMQTEDGQVVEPHSVSAGLDYPGIGPQHAHLFKTGRGQYVSITDEESLDAGLLCTQLEG 347 ******************************************************************** PP TIGR00263 340 iipalesshalaaleklapklkkdeivvvnlsGrGdkdletvak 383 iipa+es+hala+lek+ k e vvv lsGrGdkdl+t +k lcl|FitnessBrowser__Pedo557:CA265_RS05020 348 IIPAIESAHALAYLEKMEF--KGGENVVVCLSGRGDKDLDTYIK 389 ****************987..7788999***********99877 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (385 nodes) Target sequences: 1 (393 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.00s 00:00:00.01 Elapsed: 00:00:00.01 # Mc/sec: 7.86 // [ok]
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory