Align branched-chain-amino-acid transaminase (EC 2.6.1.42); glutamate-prephenate aminotransferase (EC 2.6.1.79) (characterized)
to candidate CA265_RS15785 CA265_RS15785 branched-chain-amino-acid transaminase
Query= BRENDA::P54691 (305 letters) >FitnessBrowser__Pedo557:CA265_RS15785 Length = 296 Score = 110 bits (275), Expect = 4e-29 Identities = 83/274 (30%), Positives = 133/274 (48%), Gaps = 18/274 (6%) Query: 7 IAYFEDKFVPFEDAKISVATHALHYGTAAFGGLRGIPDPEDPGTILLFRLDRHGDRLSKS 66 I Y + +F ++ + +LHYG AAF G+R +F+ H DRL +S Sbjct: 9 IIYLDGQFEKAVNSSTDLYGQSLHYGYAAFEGIRAYKTHNGNR---IFKAAAHFDRLERS 65 Query: 67 AKFLHYDISAEKIKEVIVDFVKKNQPDK--SFYIRPLVYSSGLGIAPRLHNLEKD---FL 121 + + +K +E+I K Q +K YIRPLV+ P + E L Sbjct: 66 CQLANIPFPWDK-QELIAATYKLLQLNKLKDAYIRPLVFCH-----PNMKLNEPSGVSIL 119 Query: 122 VYGLEMGDYLAADGVSCRISSWYRQEDRSFPLRGKISAAYITSALAKTEAVESGFDEAIL 181 + E Y + +S + R +S P+ K+S Y+ S LA T A G+DEA+L Sbjct: 120 ICAWEWDAYSGNKLLKLTVSDYERPNPKSIPMEAKLSGNYVNSILATTAANIKGYDEALL 179 Query: 182 MNSQGKVCEATGMNVFMVRNGQIVTPGNEQDILEGITRDSILTIAADLGIPTCQRPIDKS 241 ++ G V EA+G N+F+ ++G++ TP + +IL GITR ++ + L I ++ + Sbjct: 180 LDMHGFVAEASGANIFLEKDGKLFTP-SLGNILPGITRATVKELCTVLDIECIEKKLTIE 238 Query: 242 ELMIADEVFLSGTAAKITPVKRIENFTLGGDRPI 275 +L AD FL GTA +I + I++ RPI Sbjct: 239 DLKNADSAFLCGTATEIAGIASIDDIVY---RPI 269 Lambda K H 0.320 0.138 0.406 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 203 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 305 Length of database: 296 Length adjustment: 27 Effective length of query: 278 Effective length of database: 269 Effective search space: 74782 Effective search space used: 74782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Apr 09 2024. The underlying query database was built on Apr 09 2024.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory