Align Probable N-acetyl-gamma-glutamyl-phosphate reductase, chloroplastic; AGPR; N-acetyl-glutamate semialdehyde dehydrogenase; NAGSA dehydrogenase; EC 1.2.1.38 (characterized)
to candidate GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC
Query= SwissProt::Q93Z70 (401 letters) >lcl|FitnessBrowser__Phaeo:GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC Length = 342 Score = 361 bits (926), Expect = e-104 Identities = 180/343 (52%), Positives = 238/343 (69%), Gaps = 5/343 (1%) Query: 60 RIGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKD 119 ++ +LGASGYTGAE+VRL++ HP ++ ++A+RKAG +M VFPHLR +LP L + + Sbjct: 4 KVAILGASGYTGAELVRLISQHPTIEIAALSAERKAGMTMAQVFPHLRHLELPVLCKIGE 63 Query: 120 ADFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQ 179 DF+ +D FC LPH T+QE+I LP LKIVDLSADFRLR+ EYE+WYG PH A+ Q Sbjct: 64 IDFTGIDLCFCALPHKTSQEVIAALPQDLKIVDLSADFRLRDPDEYEKWYGNPHAALAQQ 123 Query: 180 KEVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGA 239 KE VYGL+E RE+IK ARLVA GC T Q L PL+ + +I ++II+D K VSGA Sbjct: 124 KEAVYGLSEFYREEIKSARLVAGTGCNAATGQFALRPLIASGVIDLDDIILDLKCAVSGA 183 Query: 240 GRGAKEANLYSEIAEGISSYGV-TRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQ 298 GR KE L++E++EG Y V HRH+ E +Q S +A V V FTPHL+P RG+ Sbjct: 184 GRSLKENLLHAELSEGYHGYAVGGTHRHLGEFDQEFSKIAGRPVKVQFTPHLVPANRGIL 243 Query: 299 STIYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIP 358 +T+YV+ + +HQ L T+Y DE F+++L G P T ++RGSN+CH+ V DRI Sbjct: 244 ATVYVK----GDAQTIHQTLATAYADEPFIELLPFGEAPSTRHIRGSNFCHIGVAADRIE 299 Query: 359 GRAIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP 401 GR I+I+ +DNL KG+SGQALQN N+MLG ETTGL+ PLFP Sbjct: 300 GRTIVIAALDNLTKGSSGQALQNANLMLGEEETTGLMMAPLFP 342 Lambda K H 0.318 0.134 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 414 Number of extensions: 10 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 401 Length of database: 342 Length adjustment: 30 Effective length of query: 371 Effective length of database: 312 Effective search space: 115752 Effective search space used: 115752 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
Align candidate GFF1682 PGA1_c17050 (N-acetyl-gamma-glutamyl-phosphate reductase ArgC)
to HMM TIGR01850 (argC: N-acetyl-gamma-glutamyl-phosphate reductase (EC 1.2.1.38))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01850.hmm # target sequence database: /tmp/gapView.19834.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01850 [M=345] Accession: TIGR01850 Description: argC: N-acetyl-gamma-glutamyl-phosphate reductase Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 7.6e-118 379.6 0.0 8.6e-118 379.4 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF1682 PGA1_c17050 N-acetyl-gamma-gluta Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF1682 PGA1_c17050 N-acetyl-gamma-glutamyl-phosphate reductase ArgC # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 379.4 0.0 8.6e-118 8.6e-118 2 345 .] 4 342 .] 3 342 .] 0.97 Alignments for each domain: == domain 1 score: 379.4 bits; conditional E-value: 8.6e-118 TIGR01850 2 kvaivGasGYtGaeLlrllakHpevevtklvssreagkklsevhphlkglvdlkleeleeeeileeadvvflAlph 77 kvai+GasGYtGaeL+rl+++Hp +e+++l ++r+ag ++++v+phl++l l+++ e + + +d+ f+Alph lcl|FitnessBrowser__Phaeo:GFF1682 4 KVAILGASGYTGAELVRLISQHPTIEIAALSAERKAGMTMAQVFPHLRHLELPVLCKIGEID-FTGIDLCFCALPH 78 8************************************************9998888887765.569********** PP TIGR01850 78 gvsaelvpellekgvkvidlSadfRlkdaevYekwYgkkhekeelleeavYGlpElnreeikkaklianPGCyaTa 153 ++s+e++ ++l +++k++dlSadfRl+d+++YekwYg++h++ ++++eavYGl+E++reeik+a+l+a GC+a + lcl|FitnessBrowser__Phaeo:GFF1682 79 KTSQEVI-AALPQDLKIVDLSADFRLRDPDEYEKWYGNPHAALAQQKEAVYGLSEFYREEIKSARLVAGTGCNAAT 153 *******.667999************************************************************** PP TIGR01850 154 alLalaPllkekliepksiivdaksGvSgAGrkasekslfaevnenlkpYkvt.kHrHtpEieqelsklaekkvkv 228 + al Pl+++++i+ ++ii d k +vSgAGr+ +e+ l+ae++e + Y+v +HrH E qe sk+a++ vkv lcl|FitnessBrowser__Phaeo:GFF1682 154 GQFALRPLIASGVIDLDDIILDLKCAVSGAGRSLKENLLHAELSEGYHGYAVGgTHRHLGEFDQEFSKIAGRPVKV 229 ****************************************************99********************** PP TIGR01850 229 sftphlvpmtrGilatiyaklkkelteeelrklyeevYedepfvrvlkegelPstkavlgsnfvdigvavdeetkr 304 +ftphlvp rGilat+y+k ++ ++++++++++Y+depf+++l+ ge+Pst++++gsnf++igva d+ ++r lcl|FitnessBrowser__Phaeo:GFF1682 230 QFTPHLVPANRGILATVYVKGDA----QTIHQTLATAYADEPFIELLPFGEAPSTRHIRGSNFCHIGVAADRIEGR 301 *******************9988....88*********************************************** PP TIGR01850 305 vvvvsaiDNLvKGaagqAvqnlNlmlgfdetegLeklpllp 345 +v++a+DNL+KG +gqA+qn Nlmlg +et+gL + pl+p lcl|FitnessBrowser__Phaeo:GFF1682 302 TIVIAALDNLTKGSSGQALQNANLMLGEEETTGLMMAPLFP 342 **************************************998 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (345 nodes) Target sequences: 1 (342 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.01u 0.01s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.00 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory