Align Carbamoyl-phosphate synthase small chain, chloroplastic; Carbamoyl-phosphate synthetase glutamine chain; Protein VENOSA 6; EC 6.3.5.5 (characterized)
to candidate GFF653 PGA1_c06670 carbamoyl-phosphate synthase small chain
Query= SwissProt::Q9LVW7 (430 letters) >FitnessBrowser__Phaeo:GFF653 Length = 387 Score = 343 bits (880), Expect = 5e-99 Identities = 177/378 (46%), Positives = 241/378 (63%), Gaps = 7/378 (1%) Query: 58 ARLVLEDGSIWPAKSFGAPGTRIAELVFNTSLTGYQEILTDPSYAGQFVLMTNPQIGNTG 117 A L L DG+I+ FGA G +AEL FNT++TGYQEI+TDPSYAGQ V T P IGNTG Sbjct: 11 ACLALADGTIFYGNGFGAYGETVAELCFNTAMTGYQEIMTDPSYAGQIVTFTFPHIGNTG 70 Query: 118 VNPDDEESGQCFLTGLVIRNLSISTSNWRCTKTLADYLTERDIMGVYDLDTRAITRRLRE 177 V P+D+E+ G+V++ SNWR T+ L D+LT + + + +DTR +TR +R+ Sbjct: 71 VTPEDDETADPVAAGMVVKWDPTLASNWRATEELKDWLTRTNRIAIGGIDTRRLTRAIRQ 130 Query: 178 DGSLIGVLSTEQSKTDD--ELLQMSRSWD-IVGIDLISDVSCKSPYEWVDKTNAEWDFNT 234 G+ L+ + D L+ +R W + G+DL DV+C Y W D+ W Sbjct: 131 LGAPHVALAHDPDGNFDIEALVAKAREWSGLEGLDLAKDVTCSQSYRW-DEMRWAWPEGY 189 Query: 235 NSRDGKSYKVIAYDFGIKQNILRRLSSYGCQITVVPSTFPAAEALKMNPDGILFSNGPGD 294 ++ +KV+A D+G K+NILR L+S GC +TV+P++ A E L +PDG+ SNGPGD Sbjct: 190 TRQEAPKHKVVAIDYGAKRNILRCLASAGCDVTVLPASATAEEVLAHSPDGVFLSNGPGD 249 Query: 295 PSAV-PYAVETVKELLGK--VPVYGICMGHQLLGQALGGKTFKMKFGHHGGNHPVRNNRT 351 P+A YAV ++++L +P++GIC+GHQ+L ALGGKT KM GHHG NHPV+ N T Sbjct: 250 PAATGEYAVPMIQQILDTTDLPMFGICLGHQMLALALGGKTVKMNHGHHGANHPVKENAT 309 Query: 352 GQVEISAQNHNYAVDPASLPGGVEVTHVNLNDGSCAGLSFPEMNVMSLQYHPEASPGPHD 411 G+VEI++ NH +AVD SLP GVE THV+L DGS G+ + V S+Q+HPEASPGP D Sbjct: 310 GKVEITSMNHGFAVDGQSLPDGVEETHVSLFDGSNCGIRISDRPVYSVQHHPEASPGPQD 369 Query: 412 SDNAFREFIELMKRSKQS 429 S F F E M K + Sbjct: 370 SFYLFERFAEAMAARKSA 387 Lambda K H 0.316 0.134 0.403 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 532 Number of extensions: 23 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 430 Length of database: 387 Length adjustment: 31 Effective length of query: 399 Effective length of database: 356 Effective search space: 142044 Effective search space used: 142044 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
Align candidate GFF653 PGA1_c06670 (carbamoyl-phosphate synthase small chain)
to HMM TIGR01368 (carA: carbamoyl-phosphate synthase, small subunit (EC 6.3.5.5))
# hmmsearch :: search profile(s) against a sequence database # HMMER 3.3.1 (Jul 2020); http://hmmer.org/ # Copyright (C) 2020 Howard Hughes Medical Institute. # Freely distributed under the BSD open source license. # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - # query HMM file: ../tmp/path.aa/TIGR01368.hmm # target sequence database: /tmp/gapView.17199.genome.faa # - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - Query: TIGR01368 [M=361] Accession: TIGR01368 Description: CPSaseIIsmall: carbamoyl-phosphate synthase, small subunit Scores for complete sequences (score includes all domains): --- full sequence --- --- best 1 domain --- -#dom- E-value score bias E-value score bias exp N Sequence Description ------- ------ ----- ------- ------ ----- ---- -- -------- ----------- 6.8e-135 435.6 0.0 7.8e-135 435.4 0.0 1.0 1 lcl|FitnessBrowser__Phaeo:GFF653 PGA1_c06670 carbamoyl-phosphate Domain annotation for each sequence (and alignments): >> lcl|FitnessBrowser__Phaeo:GFF653 PGA1_c06670 carbamoyl-phosphate synthase small chain # score bias c-Evalue i-Evalue hmmfrom hmm to alifrom ali to envfrom env to acc --- ------ ----- --------- --------- ------- ------- ------- ------- ------- ------- ---- 1 ! 435.4 0.0 7.8e-135 7.8e-135 1 360 [. 11 382 .. 11 383 .. 0.95 Alignments for each domain: == domain 1 score: 435.4 bits; conditional E-value: 7.8e-135 TIGR01368 1 atlvledGtvfegksfgaekevvGevvFnTsmtGYqEiltDpsYkgqivvltyplignygvneedaeskkikvkglv 77 a l+l+dGt+f g +fga +e+v+e++FnT+mtGYqEi+tDpsY+gqiv++t p+ign+gv++ed e + ++g+v lcl|FitnessBrowser__Phaeo:GFF653 11 ACLALADGTIFYGNGFGAYGETVAELCFNTAMTGYQEIMTDPSYAGQIVTFTFPHIGNTGVTPEDDETADPVAAGMV 87 5799************************************************************************* PP TIGR01368 78 vkelskevsnyrakesLeeflkeegivaiegvDTRalvkklRekgsmkavistekse...keelvekakespkvkev 151 vk + +sn+ra+e+L+++l++++ +ai g+DTR l++ +R+ g+ + +++++ e lv+ka+e ++++ lcl|FitnessBrowser__Phaeo:GFF653 88 VKWDPTLASNWRATEELKDWLTRTNRIAIGGIDTRRLTRAIRQLGAPHVALAHDPDGnfdIEALVAKAREWSGLEGL 164 *************************************************99998765555899999999******** PP TIGR01368 152 nlvkevstkeayeleq......k..akkegkklrvvvidlGvKenilreLvkrgvevtvvpadtsaeeikklnpdgi 220 +l+k+v++++ y++ + + +++e k++vv+id+G K+nilr+L++ g++vtv+pa+++aee+ + +pdg+ lcl|FitnessBrowser__Phaeo:GFF653 165 DLAKDVTCSQSYRWDEmrwawpEgyTRQEAPKHKVVAIDYGAKRNILRCLASAGCDVTVLPASATAEEVLAHSPDGV 241 ***************976655516567777779******************************************** PP TIGR01368 221 llsnGPGdPaav.eeaietvkkllea.kiPifGIclGhqllalalgaktyklkfGhrGaNhpvkdlktgrveitsqN 295 +lsnGPGdPaa e+a+ +++++l++ ++P+fGIclGhq+lalalg+kt+k++ Gh+GaNhpvk+ +tg+veits N lcl|FitnessBrowser__Phaeo:GFF653 242 FLSNGPGDPAATgEYAVPMIQQILDTtDLPMFGICLGHQMLALALGGKTVKMNHGHHGANHPVKENATGKVEITSMN 318 *********776377899******9879************************************************* PP TIGR01368 296 HgyavdeeslkeeelevthvnlnDgtveglehkelpvfsvQyHPeaspGphdteylFdefvelik 360 Hg+avd +sl+ + +e thv+l+Dg++ g++ ++ pv+svQ+HPeaspGp+d+ ylF++f e+++ lcl|FitnessBrowser__Phaeo:GFF653 319 HGFAVDGQSLPDG-VEETHVSLFDGSNCGIRISDRPVYSVQHHPEASPGPQDSFYLFERFAEAMA 382 *********8855.***********************************************9986 PP Internal pipeline statistics summary: ------------------------------------- Query model(s): 1 (361 nodes) Target sequences: 1 (387 residues searched) Passed MSV filter: 1 (1); expected 0.0 (0.02) Passed bias filter: 1 (1); expected 0.0 (0.02) Passed Vit filter: 1 (1); expected 0.0 (0.001) Passed Fwd filter: 1 (1); expected 0.0 (1e-05) Initial search space (Z): 1 [actual number of targets] Domain search space (domZ): 1 [number of targets reported over threshold] # CPU time: 0.02u 0.00s 00:00:00.02 Elapsed: 00:00:00.01 # Mc/sec: 8.93 // [ok]
This GapMind analysis is from Aug 03 2021. The underlying query database was built on Aug 03 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code, or see changes to Amino acid biosynthesis since the publication.
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory